SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001647-TA|BGIBMGA001647-PA|undefined
         (51 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_0819 - 24977204-24977290,24977372-24977746,24977823-249781...    27   1.4  

>06_03_0819 -
           24977204-24977290,24977372-24977746,24977823-24978199,
           24978456-24978770,24978861-24979296,24979386-24979463
          Length = 555

 Score = 27.5 bits (58), Expect = 1.4
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 9   YADMGVDPDSTVPQQSLTVQRTR-LQRQDGVITRESPTTSH 48
           Y D+GV+  + VP    T Q T+ L+ +D V +RE+    H
Sbjct: 498 YIDLGVETTNRVPTTQDTSQVTQCLENEDLVASREASAPLH 538


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.316    0.128    0.345 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,299,107
Number of Sequences: 37544
Number of extensions: 31788
Number of successful extensions: 71
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 71
Number of HSP's gapped (non-prelim): 1
length of query: 51
length of database: 14,793,348
effective HSP length: 32
effective length of query: 19
effective length of database: 13,591,940
effective search space: 258246860
effective search space used: 258246860
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 51 (24.6 bits)

- SilkBase 1999-2023 -