BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001647-TA|BGIBMGA001647-PA|undefined
(51 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
06_03_0819 - 24977204-24977290,24977372-24977746,24977823-249781... 27 1.4
>06_03_0819 -
24977204-24977290,24977372-24977746,24977823-24978199,
24978456-24978770,24978861-24979296,24979386-24979463
Length = 555
Score = 27.5 bits (58), Expect = 1.4
Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
Query: 9 YADMGVDPDSTVPQQSLTVQRTR-LQRQDGVITRESPTTSH 48
Y D+GV+ + VP T Q T+ L+ +D V +RE+ H
Sbjct: 498 YIDLGVETTNRVPTTQDTSQVTQCLENEDLVASREASAPLH 538
Database: rice
Posted date: Oct 3, 2007 3:31 PM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.316 0.128 0.345
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,299,107
Number of Sequences: 37544
Number of extensions: 31788
Number of successful extensions: 71
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 71
Number of HSP's gapped (non-prelim): 1
length of query: 51
length of database: 14,793,348
effective HSP length: 32
effective length of query: 19
effective length of database: 13,591,940
effective search space: 258246860
effective search space used: 258246860
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 51 (24.6 bits)
- SilkBase 1999-2023 -