BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001647-TA|BGIBMGA001647-PA|undefined (51 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0819 - 24977204-24977290,24977372-24977746,24977823-249781... 27 1.4 >06_03_0819 - 24977204-24977290,24977372-24977746,24977823-24978199, 24978456-24978770,24978861-24979296,24979386-24979463 Length = 555 Score = 27.5 bits (58), Expect = 1.4 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query: 9 YADMGVDPDSTVPQQSLTVQRTR-LQRQDGVITRESPTTSH 48 Y D+GV+ + VP T Q T+ L+ +D V +RE+ H Sbjct: 498 YIDLGVETTNRVPTTQDTSQVTQCLENEDLVASREASAPLH 538 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.128 0.345 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,299,107 Number of Sequences: 37544 Number of extensions: 31788 Number of successful extensions: 71 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 71 Number of HSP's gapped (non-prelim): 1 length of query: 51 length of database: 14,793,348 effective HSP length: 32 effective length of query: 19 effective length of database: 13,591,940 effective search space: 258246860 effective search space used: 258246860 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -