BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001647-TA|BGIBMGA001647-PA|undefined (51 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20498| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 6.6 SB_9164| Best HMM Match : COX2_TM (HMM E-Value=3.7) 25 8.7 >SB_20498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 25.4 bits (53), Expect = 6.6 Identities = 9/33 (27%), Positives = 19/33 (57%) Query: 7 EIYADMGVDPDSTVPQQSLTVQRTRLQRQDGVI 39 E++ GVD T P ++ V+R+++ Q ++ Sbjct: 58 EMHTVAGVDQSETAPMDNIVVRRSKVDPQSKLV 90 >SB_9164| Best HMM Match : COX2_TM (HMM E-Value=3.7) Length = 543 Score = 25.0 bits (52), Expect = 8.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 11 DMGVDPDSTVPQQSLTVQ 28 DM DPD+ +P +SLT + Sbjct: 277 DMEFDPDAIIPTKSLTTE 294 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.128 0.345 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,568,946 Number of Sequences: 59808 Number of extensions: 42409 Number of successful extensions: 107 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 105 Number of HSP's gapped (non-prelim): 2 length of query: 51 length of database: 16,821,457 effective HSP length: 31 effective length of query: 20 effective length of database: 14,967,409 effective search space: 299348180 effective search space used: 299348180 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -