BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001647-TA|BGIBMGA001647-PA|undefined (51 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 22 1.8 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 22 2.4 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 22.2 bits (45), Expect = 1.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 15 DPDSTVPQQSLTVQRTRLQRQDGVITRESP 44 D +TVP S + L G++TR++P Sbjct: 477 DAPTTVPSDSRVEPQELLSIAAGMVTRKAP 506 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 21.8 bits (44), Expect = 2.4 Identities = 11/26 (42%), Positives = 13/26 (50%) Query: 24 SLTVQRTRLQRQDGVITRESPTTSHS 49 SLTV R R V+ E P T H+ Sbjct: 576 SLTVSRRSCLRPARVVIVERPKTEHA 601 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.316 0.128 0.345 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,630 Number of Sequences: 2123 Number of extensions: 1200 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 51 length of database: 516,269 effective HSP length: 31 effective length of query: 20 effective length of database: 450,456 effective search space: 9009120 effective search space used: 9009120 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -