BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001647-TA|BGIBMGA001647-PA|undefined (51 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 0.39 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 19 4.8 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 0.39 Identities = 11/38 (28%), Positives = 21/38 (55%) Query: 9 YADMGVDPDSTVPQQSLTVQRTRLQRQDGVITRESPTT 46 Y D+ V D++VP V+ T ++ + I+ ++P T Sbjct: 407 YVDITVTTDASVPSLVSNVRITSVKSSELSISWDAPIT 444 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 19.0 bits (37), Expect = 4.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 21 PQQSLTVQRTRLQRQDGVITRE 42 PQQ Q+ + Q+Q G +T + Sbjct: 841 PQQQQQQQQQQQQQQRGPMTND 862 Score = 18.2 bits (35), Expect = 8.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Query: 20 VPQQSLTVQRTRLQRQDGVITRESPTTSHSA 50 V ++ L R R Q+Q T+E+ T + +A Sbjct: 1080 VKERHLMRPRKRDQKQSDDKTKETSTVTAAA 1110 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.128 0.345 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,964 Number of Sequences: 429 Number of extensions: 248 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 51 length of database: 140,377 effective HSP length: 31 effective length of query: 20 effective length of database: 127,078 effective search space: 2541560 effective search space used: 2541560 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (18.9 bits) S2: 35 (18.2 bits)
- SilkBase 1999-2023 -