GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001642-TA|BGIBMGA001642-PA|IPR001930|Peptidase M1,
membrane alanine aminopeptidase
         (544 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    23   7.2  

>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
            adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 22.6 bits (46), Expect = 7.2
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 6/35 (17%)

Query: 198  ITFTVGPLEADPEEIH--TMHN----GTWIAVIVG 226
            +TF + P E+D E IH  T+H     G W  V +G
Sbjct: 1412 LTFKLKPHESDVEPIHGYTIHYKPEFGDWETVQIG 1446


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.320    0.133    0.433 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,400
Number of Sequences: 317
Number of extensions: 3816
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 544
length of database: 114,650
effective HSP length: 60
effective length of query: 484
effective length of database: 95,630
effective search space: 46284920
effective search space used: 46284920
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 45 (22.2 bits)