GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001642-TA|BGIBMGA001642-PA|IPR001930|Peptidase M1,
membrane alanine aminopeptidase
         (544 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ219482-1|ABB29886.1|  545|Anopheles gambiae cryptochrome 1 pro...    25   5.2  

>DQ219482-1|ABB29886.1|  545|Anopheles gambiae cryptochrome 1
           protein.
          Length = 545

 Score = 25.0 bits (52), Expect = 5.2
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 3/38 (7%)

Query: 222 AVIVGNWPWPSAELSPRLGDTGMLQIVLHPNAMIRRYD 259
           +V  GNW W S+    RL D+        P A+ RR D
Sbjct: 411 SVCAGNWMWVSSSAFERLLDSSKCTC---PIALARRLD 445


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.320    0.133    0.433 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 481,591
Number of Sequences: 2123
Number of extensions: 17517
Number of successful extensions: 34
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 34
Number of HSP's gapped (non-prelim): 1
length of query: 544
length of database: 516,269
effective HSP length: 67
effective length of query: 477
effective length of database: 374,028
effective search space: 178411356
effective search space used: 178411356
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 50 (24.2 bits)