BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001642-TA|BGIBMGA001642-PA|IPR001930|Peptidase M1,
membrane alanine aminopeptidase
(544 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 24 3.7
>AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein.
Length = 652
Score = 23.8 bits (49), Expect = 3.7
Identities = 9/31 (29%), Positives = 13/31 (41%)
Query: 256 RRYDIGNETKPLQTSRWTENTTHLVWMNDTE 286
R YD E + + W TH+ W + E
Sbjct: 174 RHYDRYKEEESNENYNWEHKETHIDWQPEDE 204
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.320 0.133 0.433
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 132,146
Number of Sequences: 429
Number of extensions: 5081
Number of successful extensions: 10
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 9
Number of HSP's gapped (non-prelim): 1
length of query: 544
length of database: 140,377
effective HSP length: 61
effective length of query: 483
effective length of database: 114,208
effective search space: 55162464
effective search space used: 55162464
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 46 (22.6 bits)
- SilkBase 1999-2023 -