BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001642-TA|BGIBMGA001642-PA|IPR001930|Peptidase M1, membrane alanine aminopeptidase (544 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 24 3.7 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.8 bits (49), Expect = 3.7 Identities = 9/31 (29%), Positives = 13/31 (41%) Query: 256 RRYDIGNETKPLQTSRWTENTTHLVWMNDTE 286 R YD E + + W TH+ W + E Sbjct: 174 RHYDRYKEEESNENYNWEHKETHIDWQPEDE 204 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.133 0.433 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,146 Number of Sequences: 429 Number of extensions: 5081 Number of successful extensions: 10 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 1 length of query: 544 length of database: 140,377 effective HSP length: 61 effective length of query: 483 effective length of database: 114,208 effective search space: 55162464 effective search space used: 55162464 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -