BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001639-TA|BGIBMGA001639-PA|IPR000994|Peptidase M24, catalytic core, IPR012678|Ribosomal L23 and L15e, core (750 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 30 0.050 AM295016-1|CAL25731.1| 96|Tribolium castaneum ecdysone recepto... 27 0.62 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 24 4.4 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 4.4 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 23 5.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 7.7 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 30.3 bits (65), Expect = 0.050 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 4/67 (5%) Query: 10 PQKQPRAESSQSKLKMKKPPEIHQNDPGKTVTQSRPKRSPKQLKN--VDKNPEYYPEKVK 67 P+ + +Q L K P + G+ QSR KR PK + +NP YY + Sbjct: 181 PKAKINTGKTQYNLNSKSLPRQYSQSRGRH-NQSRSKRQPKTGREDQTRRNP-YYRPRTS 238 Query: 68 RTKPVKK 74 RT+P ++ Sbjct: 239 RTEPPRR 245 >AM295016-1|CAL25731.1| 96|Tribolium castaneum ecdysone receptor (isoform B) protein. Length = 96 Score = 26.6 bits (56), Expect = 0.62 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query: 444 RREWVSGLRGSSGTSVVTATRALVWTDARYFTQFEV-EVDGSLWEL 488 +R W + + +S VT++ ALV + A ++ +VD W+L Sbjct: 2 KRRWSARVAPEESSSEVTSSSALVMSPANSLASTDIGDVDLEFWDL 47 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 23.8 bits (49), Expect = 4.4 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Query: 176 ETINLKIN-IDRNNKKFIEKRSK-LENILGNIKTKVCNSEADVITSEEEPLIFNDD 229 +TINL+I I N F+ S L G I ++ ++ +TSE+ + NDD Sbjct: 215 QTINLQITFIWTYNDLFVMLISTALAYRFGQITRRIAAVASEKVTSEKSWIALNDD 270 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.8 bits (49), Expect = 4.4 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 5/88 (5%) Query: 496 SIQNWLVANMPPNSVVAVDPTTYTRNSWNTLQAALTRANIKLEAISENLIDLARVSIGDG 555 S+ + ++ P V VD ++ L ++ K +A S++ D+ +S Sbjct: 176 SVSPLISSSSSPPGVFPVDAPMHSPPGDGILD--FSKRGQKSDADSDS--DVVNLSKPGT 231 Query: 556 PPS-RPNNPLIPLTVNFTGRPSSDKISQ 582 PPS P N + L+V+ R + D +SQ Sbjct: 232 PPSGEPGNGPLDLSVSSRKRSNDDSVSQ 259 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 23.4 bits (48), Expect = 5.8 Identities = 11/14 (78%), Positives = 11/14 (78%) Query: 631 VAPNNIILFWGNGV 644 VAPNNIIL G GV Sbjct: 159 VAPNNIILGNGTGV 172 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 7.7 Identities = 11/34 (32%), Positives = 14/34 (41%) Query: 49 PKQLKNVDKNPEYYPEKVKRTKPVKKIIMKPKST 82 PK K +K P + P KP K P +T Sbjct: 1147 PKSAKCEEKKPGHKPSTSSWQKPTKPSYRPPSTT 1180 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.131 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,519 Number of Sequences: 317 Number of extensions: 7182 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 6 length of query: 750 length of database: 114,650 effective HSP length: 62 effective length of query: 688 effective length of database: 94,996 effective search space: 65357248 effective search space used: 65357248 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -