BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001638-TA|BGIBMGA001638-PA|IPR000994|Peptidase M24, catalytic core (630 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 25 2.5 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 24.6 bits (51), Expect = 2.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Query: 51 GSAGTAVVTSSQALVWTDGRYYTQFEREVDLS 82 G+ AV+TS Q V DG Y FE +S Sbjct: 22 GADKDAVITSQQLEVNFDGNYINNFETSNGIS 53 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.135 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,396 Number of Sequences: 429 Number of extensions: 7417 Number of successful extensions: 14 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 1 length of query: 630 length of database: 140,377 effective HSP length: 62 effective length of query: 568 effective length of database: 113,779 effective search space: 64626472 effective search space used: 64626472 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -