BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001638-TA|BGIBMGA001638-PA|IPR000994|Peptidase M24, catalytic core (630 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM295016-1|CAL25731.1| 96|Tribolium castaneum ecdysone recepto... 25 1.6 AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochr... 23 6.4 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 23 8.4 >AM295016-1|CAL25731.1| 96|Tribolium castaneum ecdysone receptor (isoform B) protein. Length = 96 Score = 25.0 bits (52), Expect = 1.6 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Query: 42 RREWISAFTGSAGTAVVTSSQALVWTDGRYYTQFE-REVDLSAWTL 86 +R W + ++ VTSS ALV + + +VDL W L Sbjct: 2 KRRWSARVAPEESSSEVTSSSALVMSPANSLASTDIGDVDLEFWDL 47 >AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q1 protein. Length = 126 Score = 23.0 bits (47), Expect = 6.4 Identities = 10/28 (35%), Positives = 18/28 (64%) Query: 140 ISNNLVDDVRMELGDPAPKRSHNELAPL 167 + ++V ++R LGD + K S+N+L L Sbjct: 18 VQESIVAEMREVLGDLSKKPSYNDLQNL 45 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 22.6 bits (46), Expect = 8.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Query: 120 RDEWTPIQTALKKISAQLVPISNNLVDD 147 RD + QT K +A ++PI +NL+ D Sbjct: 196 RDLMSCAQTGSGKTAAFMLPIIHNLLSD 223 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.135 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,447 Number of Sequences: 317 Number of extensions: 5671 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 3 length of query: 630 length of database: 114,650 effective HSP length: 61 effective length of query: 569 effective length of database: 95,313 effective search space: 54233097 effective search space used: 54233097 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -