BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001638-TA|BGIBMGA001638-PA|IPR000994|Peptidase M24, catalytic core (630 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 27 2.0 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.6 bits (56), Expect = 2.0 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Query: 350 WLHDQIDSGEQITEVQASDKLLEFRRDEKDFMGPSFG 386 WLHDQ+D G + + A + +E D P FG Sbjct: 406 WLHDQLDMGSMLHPINAYNGAVELMIPIIDIPAP-FG 441 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.317 0.135 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 630,125 Number of Sequences: 2123 Number of extensions: 26253 Number of successful extensions: 75 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 74 Number of HSP's gapped (non-prelim): 1 length of query: 630 length of database: 516,269 effective HSP length: 68 effective length of query: 562 effective length of database: 371,905 effective search space: 209010610 effective search space used: 209010610 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -