BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001638-TA|BGIBMGA001638-PA|IPR000994|Peptidase M24,
catalytic core
(630 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 27 2.0
>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
Length = 3361
Score = 26.6 bits (56), Expect = 2.0
Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 1/37 (2%)
Query: 350 WLHDQIDSGEQITEVQASDKLLEFRRDEKDFMGPSFG 386
WLHDQ+D G + + A + +E D P FG
Sbjct: 406 WLHDQLDMGSMLHPINAYNGAVELMIPIIDIPAP-FG 441
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.317 0.135 0.402
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 630,125
Number of Sequences: 2123
Number of extensions: 26253
Number of successful extensions: 75
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 74
Number of HSP's gapped (non-prelim): 1
length of query: 630
length of database: 516,269
effective HSP length: 68
effective length of query: 562
effective length of database: 371,905
effective search space: 209010610
effective search space used: 209010610
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 51 (24.6 bits)
- SilkBase 1999-2023 -