SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001638-TA|BGIBMGA001638-PA|IPR000994|Peptidase M24,
catalytic core
         (630 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle pr...    25   2.5  

>EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle
          protein protein.
          Length = 138

 Score = 24.6 bits (51), Expect = 2.5
 Identities = 13/32 (40%), Positives = 16/32 (50%)

Query: 51 GSAGTAVVTSSQALVWTDGRYYTQFEREVDLS 82
          G+   AV+TS Q  V  DG Y   FE    +S
Sbjct: 22 GADKDAVITSQQLEVNFDGNYINNFETSNGIS 53


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.317    0.135    0.402 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,396
Number of Sequences: 429
Number of extensions: 7417
Number of successful extensions: 14
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 13
Number of HSP's gapped (non-prelim): 1
length of query: 630
length of database: 140,377
effective HSP length: 62
effective length of query: 568
effective length of database: 113,779
effective search space: 64626472
effective search space used: 64626472
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 47 (23.0 bits)

- SilkBase 1999-2023 -