BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001633-TA|BGIBMGA001633-PA|undefined (88 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 20 3.4 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 19 5.9 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 20.2 bits (40), Expect = 3.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 10 VLLFANPDGKRRCALKTEG 28 +LLFA G+R+ A K G Sbjct: 347 LLLFAEQMGQRQVAFKVGG 365 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 19.4 bits (38), Expect = 5.9 Identities = 9/33 (27%), Positives = 13/33 (39%) Query: 16 PDGKRRCALKTEGHSVFEPHLVTLGYDCLKSPY 48 P + C K + EPH+ Y C+ Y Sbjct: 101 PQPSQHCPRKHGYFAHEEPHICDKFYYCVDGKY 133 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.142 0.442 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,623 Number of Sequences: 317 Number of extensions: 878 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 88 length of database: 114,650 effective HSP length: 47 effective length of query: 41 effective length of database: 99,751 effective search space: 4089791 effective search space used: 4089791 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (20.0 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -