BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001627-TA|BGIBMGA001627-PA|undefined (112 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20134| Best HMM Match : SASP_gamma (HMM E-Value=5.6) 44 3e-05 SB_23319| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.023 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 34 0.030 SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.053 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.093 SB_13055| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.093 SB_15161| Best HMM Match : MAP1B_neuraxin (HMM E-Value=2.7) 31 0.21 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 31 0.28 SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 31 0.28 SB_7667| Best HMM Match : DUF827 (HMM E-Value=0.33) 30 0.37 SB_47134| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_13494| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_31403| Best HMM Match : PAN (HMM E-Value=2.7e-18) 29 0.66 SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.87 SB_25021| Best HMM Match : TP2 (HMM E-Value=2.8) 29 0.87 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.87 SB_56913| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.87 SB_51335| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.87 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 29 0.87 SB_45044| Best HMM Match : Thioredoxin (HMM E-Value=1.1) 29 1.1 SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_58461| Best HMM Match : WH2 (HMM E-Value=0.63) 29 1.1 SB_37688| Best HMM Match : Thioredoxin (HMM E-Value=5) 29 1.1 SB_23387| Best HMM Match : REX1 (HMM E-Value=0.11) 29 1.1 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 28 1.5 SB_52234| Best HMM Match : BRF1 (HMM E-Value=0.85) 28 1.5 SB_26242| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.8e-15) 28 1.5 SB_22293| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.5 SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.5 SB_58709| Best HMM Match : CRA_rpt (HMM E-Value=1.3) 28 1.5 SB_56398| Best HMM Match : E-MAP-115 (HMM E-Value=0.53) 28 1.5 SB_50645| Best HMM Match : Syndecan (HMM E-Value=0.02) 28 1.5 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 28 1.5 SB_32414| Best HMM Match : Osteopontin (HMM E-Value=2.4) 28 1.5 SB_17534| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.51) 28 1.5 SB_13431| Best HMM Match : Seryl_tRNA_N (HMM E-Value=2.3) 28 1.5 SB_46729| Best HMM Match : DUF646 (HMM E-Value=1.9) 28 2.0 SB_33238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_27494| Best HMM Match : MFAP1_C (HMM E-Value=0) 28 2.0 SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 27 2.6 SB_56596| Best HMM Match : Gal_Lectin (HMM E-Value=2.1e-12) 27 2.6 SB_50703| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_44868| Best HMM Match : Radial_spoke (HMM E-Value=0) 27 2.6 SB_41539| Best HMM Match : PUD (HMM E-Value=0.42) 27 2.6 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 27 2.6 SB_34899| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00019) 27 2.6 SB_33143| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) 27 2.6 SB_18977| Best HMM Match : DUF834 (HMM E-Value=8.8) 27 2.6 SB_3591| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 27 2.6 SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) 27 2.6 SB_39021| Best HMM Match : M (HMM E-Value=5.3e-06) 27 2.6 SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) 27 2.6 SB_26936| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_55865| Best HMM Match : RRS1 (HMM E-Value=6.4e-07) 27 3.5 SB_9292| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.4) 27 3.5 SB_57596| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_56638| Best HMM Match : DAGK_cat (HMM E-Value=7.8e-19) 27 3.5 SB_53718| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_53028| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_33329| Best HMM Match : Mak16 (HMM E-Value=0.15) 27 3.5 SB_13524| Best HMM Match : K_tetra (HMM E-Value=3.7e-18) 27 3.5 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_10018| Best HMM Match : Sas10_Utp3 (HMM E-Value=7.6e-35) 27 3.5 SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) 27 3.5 SB_55025| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_45985| Best HMM Match : IQ (HMM E-Value=1.7e-37) 27 4.6 SB_30373| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_8110| Best HMM Match : AAA (HMM E-Value=0.0032) 27 4.6 SB_36536| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_23985| Best HMM Match : CRAM_rpt (HMM E-Value=3.4) 27 4.6 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 27 4.6 SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) 26 6.1 SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.1 SB_48624| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.1 SB_47950| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.1 SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.1 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 26 6.1 SB_42513| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 26 6.1 SB_32866| Best HMM Match : Occludin_ELL (HMM E-Value=0.25) 26 6.1 SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.1 SB_10467| Best HMM Match : zf-PARP (HMM E-Value=5.6e-35) 26 6.1 SB_3294| Best HMM Match : DUF755 (HMM E-Value=0.22) 26 6.1 SB_39476| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_29236| Best HMM Match : TMS_TDE (HMM E-Value=0) 26 8.1 SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_3141| Best HMM Match : Vicilin_N (HMM E-Value=4.1) 26 8.1 SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_54200| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_50536| Best HMM Match : Mycobact_memb (HMM E-Value=5.3) 26 8.1 SB_46201| Best HMM Match : WD40 (HMM E-Value=0) 26 8.1 SB_36817| Best HMM Match : rve (HMM E-Value=6.2e-36) 26 8.1 SB_36705| Best HMM Match : RRF (HMM E-Value=0.26) 26 8.1 SB_32968| Best HMM Match : SRP40_C (HMM E-Value=0.013) 26 8.1 SB_29732| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_29730| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 26 8.1 SB_8981| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_8090| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_2546| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 >SB_20134| Best HMM Match : SASP_gamma (HMM E-Value=5.6) Length = 126 Score = 44.0 bits (99), Expect = 3e-05 Identities = 35/112 (31%), Positives = 59/112 (52%), Gaps = 9/112 (8%) Query: 1 MAKSIRSRWKRKCRAIKRERYAVKELARLKKMLGVKD--EEKPAGSEVMESEQVIFLDAG 58 MAKS+RS+WKRK RA KR++ K +L M+G D ++ E+ + Sbjct: 1 MAKSLRSKWKRKMRAEKRKKNKEKVKQKLLDMVGTTDIVKDVTMAENTSTPEKQSNVKGN 60 Query: 59 DLKKSKKVL----EDIEKDNE-DVEMSSDDENVVVDSEGGKKRVFNT-KTLK 104 +++ +KV E + D+ DV+M +++ V S+ KK+ F + KT+K Sbjct: 61 NIEHVEKVTANNEETMAMDSAGDVDM-GEEKRVTTKSKYVKKKKFKSKKTMK 111 >SB_23319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 34.3 bits (75), Expect = 0.023 Identities = 28/106 (26%), Positives = 54/106 (50%), Gaps = 9/106 (8%) Query: 8 RWKRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKS--KK 65 RW+RK + K ER V+ A+ KK L K ++ G + E+ + L++ + ++ ++ Sbjct: 26 RWQRKEQRQKEERERVEREAK-KKELSAK-FKRDYGEAIDEAVITMTLESMNYEEDDVRR 83 Query: 66 VLEDIEKDNEDVEMSSDDENVVVDSEGGKKRVFNTKTLKDQNGQYP 111 +LED++ VE + + + E KK+V K+ K + + P Sbjct: 84 ILEDLK-----VEQEEQKKRMARELEEAKKKVAKEKSAKPKESKKP 124 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 33.9 bits (74), Expect = 0.030 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 5/85 (5%) Query: 16 IKRERYAVKELAR-LKKMLGVKDEE----KPAGSEVMESEQVIFLDAGDLKKSKKVLEDI 70 +KRE VK A L+K L +DE +P E++E + ++ LK+S + LE+ Sbjct: 723 LKRELGEVKRTAENLRKDLEGRDEVIKQLRPKVKELLEENDSLKVELESLKQSYEDLEEQ 782 Query: 71 EKDNEDVEMSSDDENVVVDSEGGKK 95 + ED +S+ E V++ EG K Sbjct: 783 YRVVEDKYLSAQKELKVLNEEGDNK 807 Score = 27.5 bits (58), Expect = 2.6 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 14/96 (14%) Query: 16 IKRERYAVKELARLKKMLGVK---------DEEKPAGSEVMESEQVIFLDAGDLKKSKKV 66 IK+ A++E RLK+ L + D+ K G+ + E I DL ++ Sbjct: 2547 IKKLEIALEEERRLKENLKSQVNDYRKRGDDQSKDFGTRMNELYVEIENYRTDLADKDRI 2606 Query: 67 LED-----IEKDNEDVEMSSDDENVVVDSEGGKKRV 97 + D ++ DNE ++ D N ++DSEG K + Sbjct: 2607 IRDQKSRQVDMDNEINKLKRDLNNQIIDSEGHFKEL 2642 >SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 33.1 bits (72), Expect = 0.053 Identities = 16/76 (21%), Positives = 45/76 (59%), Gaps = 1/76 (1%) Query: 16 IKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNE 75 +K+ R + + AR +++ K++EK GS+ ++++ + ++ + K+S+++ E+ E + Sbjct: 404 MKKSRKSAADFARDRELARKKEQEK-HGSDFEDADEEVIVEEENEKESERIKEENENVEK 462 Query: 76 DVEMSSDDENVVVDSE 91 + +S ++ V S+ Sbjct: 463 EQRTASKEKTASVGSK 478 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.093 Identities = 20/89 (22%), Positives = 45/89 (50%), Gaps = 4/89 (4%) Query: 3 KSIRSRWKRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKK 62 K + + K+K + K+ + + + KKM K+EE G + +E+E + +++ Sbjct: 26 KKKKKKKKKKKKKNKKNKKNKNKNKKKKKMKKKKEEEAEVGEKTLEAEN----EEEKIEE 81 Query: 63 SKKVLEDIEKDNEDVEMSSDDENVVVDSE 91 ++K ++ EK E+ + ++EN + E Sbjct: 82 TEKEKDEEEKIEEEEKEGGEEENEEEEEE 110 >SB_13055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1140 Score = 32.3 bits (70), Expect = 0.093 Identities = 20/74 (27%), Positives = 35/74 (47%) Query: 37 DEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKKR 96 D+E+ A E++ E+ + LD G L ++ D+E +ED MS + + Sbjct: 360 DDEQDAYEEILSDEEEMSLDDGTLDEASVQFADMELYSEDAWMSVSVSFNPYQCDLSQLM 419 Query: 97 VFNTKTLKDQNGQY 110 KT +D +GQ+ Sbjct: 420 ACVIKTKEDSDGQH 433 >SB_15161| Best HMM Match : MAP1B_neuraxin (HMM E-Value=2.7) Length = 210 Score = 31.1 bits (67), Expect = 0.21 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Query: 63 SKKVLEDIEKDNEDVEM--SSDDENVVVDSEGGKKRVFNTKTLKDQ 106 S K + + D DV SSDD + DSEG +K+VF++ + +++ Sbjct: 133 SAKKISTVSADIRDVSTDGSSDDFSAAADSEGDEKQVFDSSSDEEE 178 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 30.7 bits (66), Expect = 0.28 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Query: 36 KDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKK 95 +D E G EV E E + A L + VL I ++ E+ E + ++ VV+SE GKK Sbjct: 1694 EDVESEEGEEVEEEEAPAVVVA--LSEKASVL-GISEEREETEETVEEHEEVVESEEGKK 1750 Score = 30.3 bits (65), Expect = 0.37 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 7/80 (8%) Query: 16 IKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQV----IFLDAGDLKKSKKVLEDIE 71 ++ YAVKE + K+ V+D + A E EQV I + A D K+ + E Sbjct: 1951 VEDSEYAVKEEQEIYKLEHVEDTQDEAFKTTHEREQVEPSLIIIAAEDTKEHEPADSRGE 2010 Query: 72 KDNEDVEMS---SDDENVVV 88 ++ D+E++ +D+ +VV Sbjct: 2011 EETLDIEVAHTLEEDQMIVV 2030 Score = 28.7 bits (61), Expect = 1.1 Identities = 17/63 (26%), Positives = 35/63 (55%), Gaps = 7/63 (11%) Query: 33 LGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKD-NEDVEMSSDDENVVVDSE 91 +G+K EE+ E+ E ++ I LD + +++D+E+ E++E+S+ + + D Sbjct: 2950 VGLKHEERVNDEEIKEKDEKIHLD------EENIIQDLEETFEEELEVSAVETSKNEDER 3003 Query: 92 GGK 94 GK Sbjct: 3004 RGK 3006 Score = 25.8 bits (54), Expect = 8.1 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Query: 38 EEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKKRV 97 EE+P G VMESE+ + D + ++ E+ +++ E +E+ E ++ Sbjct: 880 EEEPMGERVMESEERRYKKGQD-EAEDELKEERGLVSKEEESKVHEESPTEAEEEEEEVA 938 Query: 98 FNTKTLKDQNGQYPV 112 + + D+ G+Y V Sbjct: 939 EDNHSTDDECGEYNV 953 >SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1805 Score = 30.7 bits (66), Expect = 0.28 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 23 VKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDA-GDLKKSKKVLEDIEKDNEDVEMSS 81 V EL + K+ L + E E +E E + D LKK ++ L+DI++D +D S Sbjct: 1425 VHELEKAKRSLEQQLAEMKQTMEELEDELQVKEDGLRQLKKYQQQLKDIQRDLDDARASR 1484 Query: 82 DD 83 D+ Sbjct: 1485 DE 1486 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 30.7 bits (66), Expect = 0.28 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 4/84 (4%) Query: 14 RAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKD 73 + ++ E+ ++EL RLK+ EE+ E +E +Q L L++ +K LE++EK+ Sbjct: 275 KLLEEEKKRLEELERLKEEKDKMLEEELKKRETLEEKQK--LQDKILEEERKRLENLEKE 332 Query: 74 NEDVE--MSSDDENVVVDSEGGKK 95 + + M + + E KK Sbjct: 333 RQAAQQAMQEAHDKLAAAEEAAKK 356 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 30.7 bits (66), Expect = 0.28 Identities = 13/35 (37%), Positives = 25/35 (71%) Query: 57 AGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSE 91 +GD+ K+K+ LE+++K E++E + D N + D+E Sbjct: 3437 SGDVNKNKEELENVKKLKEELEGAKDKLNSLNDAE 3471 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 30.7 bits (66), Expect = 0.28 Identities = 16/44 (36%), Positives = 24/44 (54%) Query: 61 KKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKKRVFNTKTLK 104 K+SKK+ ED + DN+D E DD+ D K + + +T K Sbjct: 1003 KESKKIPEDDDYDNDDDEDEDDDDLKRSDKPEKKSKAAHPETRK 1046 >SB_7667| Best HMM Match : DUF827 (HMM E-Value=0.33) Length = 806 Score = 30.3 bits (65), Expect = 0.37 Identities = 23/101 (22%), Positives = 45/101 (44%), Gaps = 11/101 (10%) Query: 1 MAKSIRSRWKRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDL 60 +++ IR C+ +K ++ + ++D EK E+ +SE+ I + D Sbjct: 567 LSREIRDEGNHVCKKVKETGQSISK--------EIQDSEKSISKEIQDSEKSISKELRDF 618 Query: 61 KKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKKRVFNTK 101 K+S L ++ + +DV DE V+ +K V + K Sbjct: 619 KQS---LREVRQKLDDVTNKDPDEAERVELAKQEKAVNDWK 656 >SB_47134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 29.9 bits (64), Expect = 0.50 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 2/38 (5%) Query: 68 EDIEKDNEDVEMSSD--DENVVVDSEGGKKRVFNTKTL 103 ED E++ E+ E+ ++ +EN V++ E GK RV + KTL Sbjct: 185 EDSEEEEEEPEIPNELEEENEVLNQELGKLRVQHQKTL 222 >SB_13494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 29.9 bits (64), Expect = 0.50 Identities = 22/107 (20%), Positives = 50/107 (46%), Gaps = 8/107 (7%) Query: 6 RSRWKRK----CRAIKRERYAVKELARLKKMLGVK--DEEKPAGSEVMESEQVIFLDAGD 59 RS W R C+ K E V ++ + +K++ VK ++ + + +++I + A Sbjct: 231 RSSWSRSRDHHCQGWKDEEIIVVKVGKDQKIIVVKAGKDQDIIVVKAGKDQEIIIVKA-- 288 Query: 60 LKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKKRVFNTKTLKDQ 106 +K ++ KD + + + D+++++ G + + K KDQ Sbjct: 289 VKDQDIIIVKAGKDQDIIVKARKDQDIIIVKAGNDEEIIVVKVGKDQ 335 >SB_31403| Best HMM Match : PAN (HMM E-Value=2.7e-18) Length = 1051 Score = 29.5 bits (63), Expect = 0.66 Identities = 23/96 (23%), Positives = 48/96 (50%), Gaps = 6/96 (6%) Query: 14 RAIKRERYAVKE-LARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEK 72 R ++ ER+ +E +A L + L + K + + I DL+K +++ + K Sbjct: 240 REVEEERHRYEEEIAHLTEQLECMERTKTEAEDKLAEMPNIAQRITDLEK---LVQQLTK 296 Query: 73 DNEDVEMSSDDENVVVDSEGGKKRVFN--TKTLKDQ 106 +N +++ + DD +V ++ G +V TK+L D+ Sbjct: 297 ENNNLKHTKDDALLVQLTQNGHYKVQQEPTKSLADE 332 >SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 29.1 bits (62), Expect = 0.87 Identities = 12/37 (32%), Positives = 24/37 (64%) Query: 55 LDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSE 91 ++ G+ ++++ L +EKD E+V S D++VV + E Sbjct: 565 MEEGEFSEAREDLAALEKDYEEVGADSPDDSVVDEDE 601 >SB_25021| Best HMM Match : TP2 (HMM E-Value=2.8) Length = 643 Score = 29.1 bits (62), Expect = 0.87 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 2/73 (2%) Query: 30 KKMLGVKDEEKPAGSEVMES-EQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVV 88 ++ L VK E KP G+++ + + G +++ L ++ +D ++S DE VV Sbjct: 395 EESLSVKLESKPLGAQIEPPPDGHVVPQQGMPLVTERELGNLTSKLQDSSLASPDEGVVS 454 Query: 89 D-SEGGKKRVFNT 100 D S GKK F++ Sbjct: 455 DISAKGKKVAFSS 467 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 29.1 bits (62), Expect = 0.87 Identities = 16/62 (25%), Positives = 35/62 (56%), Gaps = 4/62 (6%) Query: 31 KMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKD----NEDVEMSSDDENV 86 ++ ++D + A S+V SE+++ L A LK+ L+ ++KD + +E S +E+ Sbjct: 1158 EVANLRDALEKANSKVAHSEEILALKAARLKELVNELDKMKKDLDAQKQAIEESRSEESG 1217 Query: 87 VV 88 ++ Sbjct: 1218 II 1219 >SB_56913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1603 Score = 29.1 bits (62), Expect = 0.87 Identities = 23/82 (28%), Positives = 43/82 (52%), Gaps = 8/82 (9%) Query: 30 KKMLGVKDEEKPAGSEVMESEQVIFLDAGDL-----KKSKKVLEDIEKDNEDVEMSSDDE 84 ++++ V D+ +G +ES FL +GD+ K SK+ LED E +DV + S + Sbjct: 189 RRIISVYDDAAQSGMRKVESFYD-FLYSGDVDGARDKGSKRDLEDDENFYDDVPLDSSRQ 247 Query: 85 NVVVDSEGGKKRVFNTKTLKDQ 106 ++ S G +R+ + + D+ Sbjct: 248 SLA--SLGNSRRIDSDSLIYDE 267 >SB_51335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 576 Score = 29.1 bits (62), Expect = 0.87 Identities = 16/61 (26%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Query: 25 ELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDE 84 ++A L+K G ++ E +S+ ++ +K+K+V +D + N++ E SDD+ Sbjct: 225 QVAELRK--GASEQFPKKSEESDQSDDSGIVNESIKQKAKEVKKDEKDSNDEAEDDSDDD 282 Query: 85 N 85 N Sbjct: 283 N 283 >SB_8817| Best HMM Match : I-set (HMM E-Value=0) Length = 2526 Score = 29.1 bits (62), Expect = 0.87 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 5/79 (6%) Query: 38 EEKPAGSEVMESEQVIFLDAGDLKKSKKVL----EDIEKDNEDVEMSSDDENVVVDSEGG 93 +E+P E E + + GD+K + +V +E +DV +S D+ + + +G Sbjct: 440 KEEPTFLESDEIKPFEVTEEGDIKMTAQVTGKPQPSVEWFKDDVPVSPDEHITITEEDGT 499 Query: 94 KKRVFNTKTLKDQNGQYPV 112 V T KD+ G Y V Sbjct: 500 YSLVIKEPTKKDE-GTYTV 517 >SB_45044| Best HMM Match : Thioredoxin (HMM E-Value=1.1) Length = 213 Score = 28.7 bits (61), Expect = 1.1 Identities = 17/42 (40%), Positives = 29/42 (69%), Gaps = 4/42 (9%) Query: 15 AIKRERYAVKELARLKK---MLGVKDEEKPAGSE-VMESEQV 52 A+K + A +ELA + K M+ V+D+E+P+GS+ V++ E V Sbjct: 136 ALKPKFAASEELAEMSKKFVMVNVEDKEEPSGSQFVVDGEYV 177 Score = 27.5 bits (58), Expect = 2.6 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Query: 5 IRSRWKRKCRAIKRERYAVKELARLKK---MLGVKDEEKPAGSE 45 I W C+A++ + KE+A+L K M+ +++ E+P G E Sbjct: 4 ITKNWCGACKALRPKFAESKEVAQLSKKFVMVHLQENEEPDGDE 47 >SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1161 Score = 28.7 bits (61), Expect = 1.1 Identities = 22/93 (23%), Positives = 47/93 (50%), Gaps = 9/93 (9%) Query: 25 ELARLK-KMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLED-------IEKDNED 76 E+ +LK ++L +K + +++ E ++ + K+ + +E+ IE+DN Sbjct: 486 EVKKLKDELLSMKQKVMEFDAQMTEQDKELHEALNSRKELETTVEEMNVKIRSIERDNRG 545 Query: 77 VEMSSDDENVVVDSEGGKKRVFNTKTLKDQNGQ 109 +++ +D V+ E G+K K LK+ +GQ Sbjct: 546 LKVEKEDLERVL-QEAGEKVASQQKELKEAHGQ 577 >SB_58461| Best HMM Match : WH2 (HMM E-Value=0.63) Length = 592 Score = 28.7 bits (61), Expect = 1.1 Identities = 17/53 (32%), Positives = 26/53 (49%) Query: 36 KDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVV 88 + E+KP E + +E + L ++ V ED EK +DV+ D E VV Sbjct: 370 ESEKKPEAPEKLLNELLSDLAIEQEHVNELVAEDEEKSRDDVKKEHDKEGFVV 422 >SB_37688| Best HMM Match : Thioredoxin (HMM E-Value=5) Length = 119 Score = 28.7 bits (61), Expect = 1.1 Identities = 17/42 (40%), Positives = 29/42 (69%), Gaps = 4/42 (9%) Query: 15 AIKRERYAVKELARLKK---MLGVKDEEKPAGSE-VMESEQV 52 A+K + A +ELA + K M+ V+D+E+P+GS+ V++ E V Sbjct: 42 ALKPKFAASEELAEMSKKFVMVNVEDKEEPSGSQFVVDGEYV 83 >SB_23387| Best HMM Match : REX1 (HMM E-Value=0.11) Length = 1011 Score = 28.7 bits (61), Expect = 1.1 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 3/67 (4%) Query: 12 KCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIE 71 K R I+R R KE+ LK+ LG E++ +E E E+++ + +K + L + Sbjct: 374 KARVIQRLR---KEVVALKRGLGPVSEDEEDDNETDELEKLLQEERVRAEKYEDALTALN 430 Query: 72 KDNEDVE 78 K E+ E Sbjct: 431 KQYEETE 437 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 28.3 bits (60), Expect = 1.5 Identities = 17/50 (34%), Positives = 28/50 (56%) Query: 45 EVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGK 94 ++ ESE+VI L DL K K +E++++ +E S D+N + GK Sbjct: 423 KLQESEKVIELRKKDLGKKDKTIEELKERIIVLEKSLKDKNDEIFGIEGK 472 >SB_52234| Best HMM Match : BRF1 (HMM E-Value=0.85) Length = 371 Score = 28.3 bits (60), Expect = 1.5 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Query: 32 MLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDE 84 M+G DE K A +E ++SE + L+A K+ + + +ED ++ DD+ Sbjct: 173 MIGTSDERK-AQTEEIQSEYLKSLEADRAKQQSPLASPPPQLSEDDHLNEDDQ 224 >SB_26242| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.8e-15) Length = 1019 Score = 28.3 bits (60), Expect = 1.5 Identities = 16/73 (21%), Positives = 35/73 (47%), Gaps = 3/73 (4%) Query: 17 KRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNED 76 K +RY ++ M +E ++E LDA K+++++LE++ K+ ED Sbjct: 521 KYQRYIATSDRTIQNMKYQLNEVSNQRDAIIEERDYALLDA---KEARELLEEVLKEKED 577 Query: 77 VEMSSDDENVVVD 89 + ++ N ++ Sbjct: 578 LGFRLEESNCEIE 590 >SB_22293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1239 Score = 28.3 bits (60), Expect = 1.5 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 61 KKSKKVLEDIEKDNEDVEMSSD-DENVVVDSE 91 K + K++ D + N+D E S+D DEN +VD E Sbjct: 86 KDNGKIVSDDDNGNDDDEDSNDEDENGIVDHE 117 >SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 28.3 bits (60), Expect = 1.5 Identities = 15/56 (26%), Positives = 26/56 (46%) Query: 36 KDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSE 91 K++++ E M+ E + G++ K K D E D E+++ D E D E Sbjct: 113 KEDKEEMDKEEMDKEDKEEMGKGEMDKEDKEEMDQEMDKEEMDQEMDKEMDKEDKE 168 Score = 25.8 bits (54), Expect = 8.1 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Query: 24 KELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEK-DNEDVEMSSD 82 KE K+ + +D+E E M+ E +D D K++K+ E+++K D E+++ Sbjct: 6 KENKEDKEEMDKQDKENKEDKEKMDKEDKEEMDKQD-KENKEDKEEMDKEDKEEMDQEEM 64 Query: 83 DE 84 D+ Sbjct: 65 DK 66 >SB_58709| Best HMM Match : CRA_rpt (HMM E-Value=1.3) Length = 112 Score = 28.3 bits (60), Expect = 1.5 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 5/53 (9%) Query: 60 LKKSKKVL-EDIEKDNEDVEMSSDDENVVVDSE----GGKKRVFNTKTLKDQN 107 + + KKVL ED + +ED +M S+DE VV + + G KK + + KT++ ++ Sbjct: 2 VSEDKKVLSEDKKVLSEDKKMVSEDEKVVSEDKKMVSGDKKVLSDYKTVQSED 54 >SB_56398| Best HMM Match : E-MAP-115 (HMM E-Value=0.53) Length = 502 Score = 28.3 bits (60), Expect = 1.5 Identities = 16/73 (21%), Positives = 35/73 (47%), Gaps = 3/73 (4%) Query: 17 KRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNED 76 K +RY ++ M +E ++E LDA K+++++LE++ K+ ED Sbjct: 249 KYQRYIATSDRTIQNMKYQLNEVSNQRDAIIEERDYALLDA---KEARELLEEVLKEKED 305 Query: 77 VEMSSDDENVVVD 89 + ++ N ++ Sbjct: 306 LGFRLEESNCEIE 318 >SB_50645| Best HMM Match : Syndecan (HMM E-Value=0.02) Length = 226 Score = 28.3 bits (60), Expect = 1.5 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 4/70 (5%) Query: 36 KDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGG-K 94 K +++ +E+E+V A +K ++K E ++ ED M +D EN EG + Sbjct: 101 KPKDRKTKEPKVETEEVEITTAEPVKPTEKPTEFVKPTTEDDVMETDPEN---PKEGDMQ 157 Query: 95 KRVFNTKTLK 104 RV K LK Sbjct: 158 ARVSEKKRLK 167 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 28.3 bits (60), Expect = 1.5 Identities = 18/63 (28%), Positives = 36/63 (57%), Gaps = 8/63 (12%) Query: 30 KKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLED-IEKDNEDVEMSSDDENVVV 88 ++M+ +DEE G E E E GD+++ + ED IE+++ D ++ DD+++ Sbjct: 1811 EEMMEDEDEEADKGDEEEEEE-------GDVEEEEDEEEDEIEEEDYDEDIGDDDDDLEE 1863 Query: 89 DSE 91 ++E Sbjct: 1864 EAE 1866 >SB_32414| Best HMM Match : Osteopontin (HMM E-Value=2.4) Length = 777 Score = 28.3 bits (60), Expect = 1.5 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 5/77 (6%) Query: 31 KMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDS 90 K L D E A E E + ++A K S+K EDIE + + SDDE + Sbjct: 431 KSLNSTDNENEADEEKEEDTKSESIEAESEKTSEKDEEDIESTISE-KKDSDDEEEQESA 489 Query: 91 EGGKKRVFNTKTLKDQN 107 + G ++ LKD++ Sbjct: 490 DDG----YSESGLKDES 502 >SB_17534| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.51) Length = 976 Score = 28.3 bits (60), Expect = 1.5 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 8/82 (9%) Query: 15 AIKRERYAVKELARLKKML---GVKDEEKPAGSEVM---ESEQVIFLDAGDLKKSKKVLE 68 A+ ++R +++L +L+KM GV EE A E E ++ + D K+ KK + Sbjct: 410 ALLKKRTTLRDL-QLRKMAREEGVSIEEIEAREEAAGGDEEQKEKMKERKDKKEEKKDKD 468 Query: 69 -DIEKDNEDVEMSSDDENVVVD 89 D +KD ED S++E +D Sbjct: 469 KDKDKDEEDDSSDSEEEREAMD 490 >SB_13431| Best HMM Match : Seryl_tRNA_N (HMM E-Value=2.3) Length = 743 Score = 28.3 bits (60), Expect = 1.5 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Query: 68 EDIEKDNEDVEMSSDDENVVVDSEGGKK-RVFNTKTLKDQN 107 EDI D++++E SD E + D E K+ + KT+ DQ+ Sbjct: 474 EDINTDDDELEEDSDQEELPSDHELQKQINKVHMKTMMDQD 514 >SB_46729| Best HMM Match : DUF646 (HMM E-Value=1.9) Length = 202 Score = 27.9 bits (59), Expect = 2.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Query: 57 AGDLKKSKKVLEDIEKDNED 76 AGDL +KK L+DIE+D D Sbjct: 80 AGDLNTTKKSLDDIEQDVRD 99 >SB_33238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 27.9 bits (59), Expect = 2.0 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Query: 44 SEVMESEQVIFLDAGDLKKSKKVLEDIEKDN-EDVEMSSDDENVVVDSE 91 S+V+ V D D+ V++D + D +DV+++ DD++ V+D + Sbjct: 54 SDVINDVDVNNDDDSDVIDDADVIDDDDSDRIDDVDVNDDDDSDVIDDD 102 >SB_27494| Best HMM Match : MFAP1_C (HMM E-Value=0) Length = 808 Score = 27.9 bits (59), Expect = 2.0 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Query: 37 DEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIE---KDNEDVEMSSDDENVVVDSE 91 DEE+ E+ Q++ L A K+++K L D+E K E+ E S + DSE Sbjct: 192 DEEEIDEEEIERRRQMLRLKAQQKKEAEKDLLDLEDEVKSEEEEEEESSEYEEYSDSE 249 >SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 27.9 bits (59), Expect = 2.0 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 5/75 (6%) Query: 34 GVKDEE-----KPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVV 88 G KDEE KP ++ E++ L ++ K + +D EKD ED + +E + Sbjct: 270 GSKDEEEDATVKPNPPPHLDEEKIKQLHEELKEEIKSMAKDSEKDLEDAKKDLKEEIEQI 329 Query: 89 DSEGGKKRVFNTKTL 103 E G R K L Sbjct: 330 KEEVGYLRYMEAKQL 344 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 27.5 bits (58), Expect = 2.6 Identities = 17/77 (22%), Positives = 37/77 (48%) Query: 10 KRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLED 69 KRK R + R A + R ++ ++E+K E+ E E+ + + D +K K+ L + Sbjct: 1161 KRKAREERESRRAAEAERRRLEVQKKREEKKKREEEMREKEKEMEQNKIDQEKRKQELME 1220 Query: 70 IEKDNEDVEMSSDDENV 86 + E+ + ++ + Sbjct: 1221 SRRFQEEQDRLEEERRL 1237 >SB_56596| Best HMM Match : Gal_Lectin (HMM E-Value=2.1e-12) Length = 232 Score = 27.5 bits (58), Expect = 2.6 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Query: 37 DEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENV 86 +E KPA ++ E Q DA ++ ++ K + + E ++ E+ DDENV Sbjct: 24 EEAKPASTQNEELLQ----DAPEVDETPKEMTEDETEDIPTEVEDDDENV 69 >SB_50703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.5 bits (58), Expect = 2.6 Identities = 13/53 (24%), Positives = 28/53 (52%) Query: 36 KDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVV 88 ++EE+ E E E+ + + K+ K+ ED +++ ED+ + D ++V Sbjct: 59 EEEEEEEEEEEEEEEEEEEEEEEEEKEDKQEEEDKQEEEEDIRAENQDHELIV 111 >SB_44868| Best HMM Match : Radial_spoke (HMM E-Value=0) Length = 375 Score = 27.5 bits (58), Expect = 2.6 Identities = 15/48 (31%), Positives = 24/48 (50%) Query: 38 EEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDEN 85 EE P EV E + + LKK+++ + D EDV+ DD++ Sbjct: 328 EEYPTVPEVTEVDDPTVEEERALKKAQEEAMEAADDMEDVDDDDDDDD 375 >SB_41539| Best HMM Match : PUD (HMM E-Value=0.42) Length = 1582 Score = 27.5 bits (58), Expect = 2.6 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 5/78 (6%) Query: 17 KRERYAVKELARLK-KMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNE 75 K+E+ A K+ A+ K K G EV E E + + + K + E+ E Sbjct: 1253 KKEKKAAKKAAKKKRKAEAAAAAAVEVGVEVKEGEN----EEEEEEVKKDIAEEEEAAPA 1308 Query: 76 DVEMSSDDENVVVDSEGG 93 + E S+D + + +EGG Sbjct: 1309 EPEEESEDTTLAIHAEGG 1326 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 27.5 bits (58), Expect = 2.6 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 5/74 (6%) Query: 35 VKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVE--MSSDDENVVVDSEG 92 V DE K E+M Q ++ D L+K LE+ +K E+ + E V+ + + Sbjct: 10 VDDESKDGDDELMSEFQKVYSDNESLQKRVSELEEHQKVIEETNETLKKQHETVLFEKD- 68 Query: 93 GKKRVFNTKTLKDQ 106 + KTL+++ Sbjct: 69 --ELTLTIKTLQEE 80 >SB_34899| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00019) Length = 1136 Score = 27.5 bits (58), Expect = 2.6 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 4/82 (4%) Query: 1 MAKSIRSRWKRKCRAIKRERYAVKELARLKKMLGVKDEE-KPAGSEVMESEQVIFLDAGD 59 + +S+ S ++ + + A+KEL ++ LG ++E +EV E E I D Sbjct: 272 VVESLSSDCEKYKELVMSKDIAMKEL---EQYLGKTNKELSQTKTEVAEKEAAIASLRVD 328 Query: 60 LKKSKKVLEDIEKDNEDVEMSS 81 L+ K+ ED K +D+E S Sbjct: 329 LQNKTKLSEDENKRIQDIEEES 350 >SB_33143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.5 bits (58), Expect = 2.6 Identities = 18/81 (22%), Positives = 35/81 (43%), Gaps = 4/81 (4%) Query: 11 RKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDI 70 R+ R I R + + K+ DEE + E S++V + + +E+ Sbjct: 42 RRTRDINRTEVKTETITETKR----SDEETKSDQETNRSDEVTKRSEPETTDRTEKVEES 97 Query: 71 EKDNEDVEMSSDDENVVVDSE 91 EK N D ++D+ + ++E Sbjct: 98 EKQNSDKINNNDETQIESNAE 118 >SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) Length = 847 Score = 27.5 bits (58), Expect = 2.6 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 2/76 (2%) Query: 10 KRKCRAIKRERYAVKELARLKKMLGVKDEEK--PAGSEVMESEQVIFLDAGDLKKSKKVL 67 + K + + K A+ + L + E K A S + ESE A LK ++ + Sbjct: 736 QEKLEGVSKASEQSKTHAQKLESLNKEQENKLVDAQSRLEESEAEGRKTAHLLKLKEQKI 795 Query: 68 EDIEKDNEDVEMSSDD 83 E +EK E++E++ DD Sbjct: 796 ESLEKKVEELELNQDD 811 >SB_18977| Best HMM Match : DUF834 (HMM E-Value=8.8) Length = 119 Score = 27.5 bits (58), Expect = 2.6 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 5/78 (6%) Query: 17 KRERYAVKELARLK-KMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNE 75 K+E+ A K+ A+ K K G EV E E + + + K + E+ E Sbjct: 19 KKEKKAAKKAAKKKRKAEAAAAAAVEVGVEVKEGEN----EEEEEEVKKDIAEEEEAAPA 74 Query: 76 DVEMSSDDENVVVDSEGG 93 + E S+D + + +EGG Sbjct: 75 EPEEESEDTTLAIHAEGG 92 >SB_3591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1585 Score = 27.5 bits (58), Expect = 2.6 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Query: 4 SIRSRWKRKCRAIKRERYAVKELARLKKMLGVKDEEKP 41 + R KR+ R RER AVK++A + + LG+ + KP Sbjct: 1049 TFREAQKRR-RECLRERIAVKDIAFVVRSLGLMRKSKP 1085 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 27.5 bits (58), Expect = 2.6 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 6/82 (7%) Query: 28 RLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVV 87 +LK ML +D++K +EV + ++ I DL++ K+ LED +D++ DE + Sbjct: 71 QLKAML--EDQKKEHMAEVRKFQREI----DDLRRQKRSLEDQLRDSKGDNKRLQDELNM 124 Query: 88 VDSEGGKKRVFNTKTLKDQNGQ 109 V +K N L++ N + Sbjct: 125 VRRRLLEKETENESLLRELNSK 146 >SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) Length = 690 Score = 27.5 bits (58), Expect = 2.6 Identities = 25/106 (23%), Positives = 48/106 (45%), Gaps = 8/106 (7%) Query: 6 RSRWKRKCRAIKRERYAVKELARLKKML----GVKDEEKPAGSEVMESEQVIFL--DAGD 59 ++++ + +K ER + EL K L + EE + E+E ++ + Sbjct: 441 QAKYTSMLKDLKNERNKIIELEEKLKALEEQNSQRQEEYDSNKSTHENELLVLKAKHEEE 500 Query: 60 LKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKKRVFNTKTLKD 105 LK++K+ LE++EK E E + ++ ++ E K N K D Sbjct: 501 LKETKQQLEELEK--EKSEKLTKEQEEALEEERKKLTEANEKFAAD 544 >SB_39021| Best HMM Match : M (HMM E-Value=5.3e-06) Length = 1691 Score = 27.5 bits (58), Expect = 2.6 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 5/68 (7%) Query: 18 RERYAVKELARLKKMLGVKDE-EKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNED 76 +ER +K R + K+E +K + E + EQ IF DL++ +K +ED K +D Sbjct: 145 KEREELKGKLRAEVWSEAKEEAKKDSEREKVRLEQEIF----DLRRQRKEVEDALKIIQD 200 Query: 77 VEMSSDDE 84 + DE Sbjct: 201 ADKRKADE 208 >SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) Length = 205 Score = 27.5 bits (58), Expect = 2.6 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 36 KDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDEN 85 ++EEK G E + E+ + D + SK + ++ NE E + DE+ Sbjct: 111 EEEEKEEGKE-EDGEEEVVTDERGISSSKDESNESDESNESDESNESDES 159 >SB_26936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 27.5 bits (58), Expect = 2.6 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 5/78 (6%) Query: 17 KRERYAVKELARLK-KMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNE 75 K+E+ A K+ A+ K K G EV E E + + + K + E+ E Sbjct: 268 KKEKKAAKKAAKKKRKAEAAAAAAVEVGVEVKEGEN----EEEEEEVKKDIAEEEEAAPA 323 Query: 76 DVEMSSDDENVVVDSEGG 93 + E S+D + + +EGG Sbjct: 324 EPEEESEDTTLAIHAEGG 341 >SB_55865| Best HMM Match : RRS1 (HMM E-Value=6.4e-07) Length = 424 Score = 27.1 bits (57), Expect = 3.5 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Query: 10 KRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVME-SEQVIFLDAGDLKKSK-KVL 67 K+K R K E ++ +A+ KK++ + A + V + +E++ AG+ K K L Sbjct: 296 KKKERIAKNEYQRLRNIAKHKKIMAAIGATRKATASVGKFTEKLFDAVAGEYSSEKTKTL 355 Query: 68 EDIEK 72 E +EK Sbjct: 356 EVVEK 360 >SB_9292| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.4) Length = 184 Score = 27.1 bits (57), Expect = 3.5 Identities = 32/114 (28%), Positives = 60/114 (52%), Gaps = 9/114 (7%) Query: 3 KSIRSRWKRKCRAIKRERYAVKELARLKKML--GVKDEEKPAGSEVM--ESEQVIFLDAG 58 K+ R +K K +A R + +E+A+ KML G+K +++ ++ ++E L+ Sbjct: 33 KNKRLSFKLKQKA--RRKALKQEIAKRAKMLEDGIKKQKESLLQQLYLPDTELKAELNRF 90 Query: 59 D--LKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKKRVFNTKTLKDQNGQY 110 D LKKS + +E+IEK ++ +S + E KK + NT T+ +N ++ Sbjct: 91 DMFLKKSSRCMENIEKILKESNLSDIAKQSGAYIEQLKK-LRNTPTVNFRNIEF 143 >SB_57596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 27.1 bits (57), Expect = 3.5 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Query: 37 DEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDEN 85 DE+ G +E E+ + DLK + +++D E+++E E + D+E+ Sbjct: 7 DEDDNKGDSEVEMEEEVSDLYDDLKNDRDLIDDEERESEK-ENNCDEES 54 >SB_56638| Best HMM Match : DAGK_cat (HMM E-Value=7.8e-19) Length = 836 Score = 27.1 bits (57), Expect = 3.5 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Query: 44 SEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKKRVFNTKTL 103 SE ES++ I D SK L ++N + D +N ++D K V N+K Sbjct: 741 SEEEESQKTILSDDWCFLDSKFGLTYNHENNYNYNGDEDSDN-IIDDNNDNKDVNNSKNY 799 Query: 104 KDQ 106 DQ Sbjct: 800 HDQ 802 >SB_53718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.1 bits (57), Expect = 3.5 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 8/89 (8%) Query: 5 IRSRWKRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSK 64 ++S + + + Y +KE A K+ G +E A +V + +DAGD+ K Sbjct: 74 LKSGYSLDVAILAKSSYFLKEFAA-DKIFGAGVKEVDAADDVED------VDAGDVVKDV 126 Query: 65 KVLEDIEKDN-EDVEMSSDDENVVVDSEG 92 +D+E N DV D + V + +G Sbjct: 127 DAADDVEDVNAADVVKDVDAADDVEEEDG 155 >SB_53028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 27.1 bits (57), Expect = 3.5 Identities = 19/88 (21%), Positives = 38/88 (43%), Gaps = 8/88 (9%) Query: 4 SIRSRWKRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKS 63 S+ S W C + +RE+ + +L+ + + K A ++ E+ ++ AG Sbjct: 125 SLNSSWGHCCLSSRREQVLAADATQLELHTKAQQQCKAASNKPRETPTIVITSAGS---- 180 Query: 64 KKVLEDIEKDNEDVEMSSDDENVVVDSE 91 ED E + +E +S D V + + Sbjct: 181 ----EDWEDWDASMECTSIDSGVKTNGD 204 >SB_33329| Best HMM Match : Mak16 (HMM E-Value=0.15) Length = 265 Score = 27.1 bits (57), Expect = 3.5 Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 9/84 (10%) Query: 11 RKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDI 70 RK +AI+ E+Y V ++KK G +P + + DA + S D Sbjct: 61 RKLKAIQAEKYPV---VKIKKPPG-----RPRNVDTTSIDNDNSRDAASIADSSIQGND- 111 Query: 71 EKDNEDVEMSSDDENVVVDSEGGK 94 + D+E+ E DDE D E G+ Sbjct: 112 DDDDEEEEEDDDDEEEEDDDEDGE 135 >SB_13524| Best HMM Match : K_tetra (HMM E-Value=3.7e-18) Length = 495 Score = 27.1 bits (57), Expect = 3.5 Identities = 23/93 (24%), Positives = 45/93 (48%), Gaps = 4/93 (4%) Query: 17 KRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGD---LKKSKKVLEDIEKD 73 K E+ K+ LKK+ ++ EK A ++ E+VI D + L++S + E Sbjct: 253 KMEKLRAKKDEMLKKIEEFEEREKAAMKKIARLEEVIAKDKNESATLRRSCSLTEHQFDK 312 Query: 74 NEDVEMSSDDENVVVDSEGGKKRVFNTKTLKDQ 106 ED+ + E +V+ + ++ + K L+D+ Sbjct: 313 TEDI-LDQKLERLVMLHKKTEQDIQMLKVLEDR 344 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 27.1 bits (57), Expect = 3.5 Identities = 19/85 (22%), Positives = 42/85 (49%), Gaps = 9/85 (10%) Query: 18 RERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDV 77 R++Y +++ K++ +DE + ++E +LK KK + D+E DN+++ Sbjct: 1605 RDKYQLEKEEAEKRLQSYEDELNEKQKQKEKAED-------NLKALKKRISDLEVDNKNL 1657 Query: 78 EMSSDDENVVVDSEGGKKRVFNTKT 102 E + D N V + + ++ +T Sbjct: 1658 ETARD--NAVYERDIANQKFVEQRT 1680 >SB_10018| Best HMM Match : Sas10_Utp3 (HMM E-Value=7.6e-35) Length = 430 Score = 27.1 bits (57), Expect = 3.5 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 2/69 (2%) Query: 24 KELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDD 83 K A+ KK +EE ESE D G SK +++E D++D + DD Sbjct: 26 KRSAKPKKK-AESEEESDISEPDPESEDYFKDDVGKFH-SKSDKDNVEDDDDDDDGGDDD 83 Query: 84 ENVVVDSEG 92 E+ +EG Sbjct: 84 EDDDGQTEG 92 >SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) Length = 1058 Score = 27.1 bits (57), Expect = 3.5 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 64 KKVLEDIEKDNEDVEMSSDDENVV-VDSEGGKKRVFNTKTL 103 K V +D+EKD+E EM D+ V+ + G R KTL Sbjct: 6 KTVEKDLEKDDEKEEMEIDEVPVIQAGRQSGMHRFHLGKTL 46 >SB_55025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2468 Score = 26.6 bits (56), Expect = 4.6 Identities = 21/63 (33%), Positives = 37/63 (58%), Gaps = 7/63 (11%) Query: 36 KDEEKPAGSEV-MESEQVI---FLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSE 91 ++E++P G+E + +E+V+ LD GDL + + IE +++D SSD E+ D E Sbjct: 322 RNEQRPNGAEGDVVAEEVVSRHHLD-GDLVEETHYI--IEGNDDDESSSSDSEDDGDDDE 378 Query: 92 GGK 94 G + Sbjct: 379 GSE 381 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 26.6 bits (56), Expect = 4.6 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 4/104 (3%) Query: 6 RSRWKRKCRAIKR--ERYAVKELARLKKMLG-VKDEEKPAGSEVMESEQVIFLDAGDLKK 62 R R +R KR E+ V+ L LK++L V D+ E + E+ + + +++ Sbjct: 235 RQREQRIAEKRKRLEEQRKVESLHLLKELLKRVADKRAEEEEEKRKREKELEM-LRQIEE 293 Query: 63 SKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKKRVFNTKTLKDQ 106 K+ LE+ E+ E+VE + + E K + N K +K++ Sbjct: 294 KKRKLEEEERIKEEVEKQKKIKLEQQEKELRDKLLKNLKEMKER 337 >SB_45985| Best HMM Match : IQ (HMM E-Value=1.7e-37) Length = 942 Score = 26.6 bits (56), Expect = 4.6 Identities = 18/61 (29%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Query: 36 KDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIE-KDNEDVEMSSDDENVVVDSEGGK 94 K E+ ++ E D+GD + D E D++D SDDE D E G Sbjct: 599 KSEKSSIATDTSEHPSDSSSDSGDDSDDESSDSDDEPSDSDDEPSKSDDEPTKSDEERGD 658 Query: 95 K 95 K Sbjct: 659 K 659 >SB_30373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 26.6 bits (56), Expect = 4.6 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Query: 49 SEQVIFLDAGDLKKSKKVLEDIEKDN-EDVEMSSDDENVVVDSEGG 93 +E V++ +A ++ + EKD+ ED E SDDE+ +SE G Sbjct: 270 NEYVVYNEAQSTQRYLVFVGSEEKDSGEDKESDSDDESESDESEEG 315 >SB_8110| Best HMM Match : AAA (HMM E-Value=0.0032) Length = 1199 Score = 26.6 bits (56), Expect = 4.6 Identities = 15/54 (27%), Positives = 25/54 (46%) Query: 16 IKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLED 69 IKRE+ KEL K++L +++ K A S + + + D +ED Sbjct: 581 IKREKTLRKELELQKRLLAKQNKSKAASSSMWKEDSDSDFQQSDSDSEGSCVED 634 >SB_36536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 26.6 bits (56), Expect = 4.6 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Query: 59 DLKKSKKVLEDIEKDNEDVEMSSDD 83 D+++ K +LED+E + E VE + DD Sbjct: 312 DMERIKNILEDVEAEQE-VERTGDD 335 >SB_23985| Best HMM Match : CRAM_rpt (HMM E-Value=3.4) Length = 323 Score = 26.6 bits (56), Expect = 4.6 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Query: 36 KDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDEN 85 ++EEK G E E+V+ + G + SK ++ ++ NE E + D++ Sbjct: 56 EEEEKEEGKEEDGEEEVVTDERG-ISSSKDESDESDESNESDESNESDKS 104 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 26.6 bits (56), Expect = 4.6 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 7/53 (13%) Query: 30 KKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSD 82 KK+ +KDE ++++E+E G+L + ++ LE+ EK D++ +SD Sbjct: 2413 KKLESLKDEYSGEKTKLVEAE-------GNLARVQRDLEEKEKKLNDIKQASD 2458 >SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) Length = 4607 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 4 SIRSRWKRKCRAIKRERYAVKE-LARLKKML 33 S+RSRW ++ ++ E+ VKE L +L ++L Sbjct: 713 SLRSRWSKRVHSLIDEKTRVKEKLRKLNRIL 743 >SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 26.2 bits (55), Expect = 6.1 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 5/90 (5%) Query: 3 KSIRSRWKRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKK 62 K + + K+K + + E +E K+ ++EE+ E E E+ L A D Sbjct: 177 KKKKKKKKKKKKKKEEEEEEEEEEEEEKEEKEEEEEEEEEEEEEEEEEEGCALQACDQGG 236 Query: 63 SKKVLEDIEKDNEDVEMSSDDENVVVDSEG 92 + E++ E+ E S DD++V + EG Sbjct: 237 GGE-----EEEKEEGEGSKDDDDVGEEKEG 261 >SB_48624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 813 Score = 26.2 bits (55), Expect = 6.1 Identities = 15/69 (21%), Positives = 34/69 (49%), Gaps = 3/69 (4%) Query: 19 ERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVI---FLDAGDLKKSKKVLEDIEKDNE 75 +++ +K++ L LGVK +KP E+ + L+ ++ SK + ++ + Sbjct: 708 KQFKIKDMGELHHFLGVKVIQKPETGELWIGQSTYGKGVLERFGMENSKAISTPVDASTK 767 Query: 76 DVEMSSDDE 84 V+ ++D E Sbjct: 768 LVKATNDYE 776 >SB_47950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 26.2 bits (55), Expect = 6.1 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 3/74 (4%) Query: 24 KELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSK-KVLEDIEKDNEDVEMSSD 82 KE K G K++ K +EV+E D G K++K K +D E+ +E+ SD Sbjct: 189 KEQTSRTKRKGKKEKRKRK-TEVIEISDNEASDTGKAKETKIKKKKDKERVESILEI-SD 246 Query: 83 DENVVVDSEGGKKR 96 E+ D KK+ Sbjct: 247 SESAENDENNSKKK 260 >SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3306 Score = 26.2 bits (55), Expect = 6.1 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Query: 22 AVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSS 81 A +EL+++KK + V D KP + + +V+ G S VL+ +E+ + + + Sbjct: 2907 AHEELSKVKKCVAVLDSRKPTLHTLKQHGKVLAEKTG----SPDVLDKVEEAEQKYDSTE 2962 Query: 82 DDE 84 D+ Sbjct: 2963 SDK 2965 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 26.2 bits (55), Expect = 6.1 Identities = 14/49 (28%), Positives = 24/49 (48%) Query: 59 DLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKKRVFNTKTLKDQN 107 +L K K+L+ DN + ++S + +D+E TK L+D N Sbjct: 867 NLNKLAKILKQRRIDNGALTLASSEVRFFIDNETHDPIDVETKQLRDTN 915 >SB_42513| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) Length = 519 Score = 26.2 bits (55), Expect = 6.1 Identities = 16/70 (22%), Positives = 38/70 (54%), Gaps = 2/70 (2%) Query: 39 EKPAGSEVMESEQVIFLDAGD-LKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKKRV 97 +KP + + V+F + L++ +L+ ++N D+E+S++ +++ ++ GKK Sbjct: 362 DKPLNCLLYADDLVLFSTSEKGLQRKLDILDSFCREN-DLEISTEKTKLIIFNKNGKKLS 420 Query: 98 FNTKTLKDQN 107 T+K Q+ Sbjct: 421 RYGLTVKGQS 430 >SB_32866| Best HMM Match : Occludin_ELL (HMM E-Value=0.25) Length = 1034 Score = 26.2 bits (55), Expect = 6.1 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 7/84 (8%) Query: 1 MAKSIRSRWKRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDL 60 + + I++ ++K ++ E KE+ RLK L K++ ++ + E+++ A + Sbjct: 61 LEEQIKNFQQQKLKSQSHESDNAKEIERLKAALEAKNK------QMYDLEEIVRSSAEKM 114 Query: 61 KKSKKVLEDIEKDNEDVEMSSDDE 84 ++ KK ED EK E + E Sbjct: 115 EQMKKEFED-EKQRMQKEFEKNLE 137 >SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1821 Score = 26.2 bits (55), Expect = 6.1 Identities = 15/71 (21%), Positives = 31/71 (43%) Query: 10 KRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLED 69 +++C I++E A ++ L + E P G V D + K++++ Sbjct: 1457 EKRCAVIEKEALAATRVSTEDGKLRTRCEVCPGGPPEHSRRPVTCPDKQATLEDLKLVDE 1516 Query: 70 IEKDNEDVEMS 80 +EK +E + S Sbjct: 1517 VEKQSESILQS 1527 >SB_10467| Best HMM Match : zf-PARP (HMM E-Value=5.6e-35) Length = 1311 Score = 26.2 bits (55), Expect = 6.1 Identities = 22/89 (24%), Positives = 37/89 (41%), Gaps = 5/89 (5%) Query: 10 KRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLED 69 + KC+ K + K AR+ K+ E + + IF + + K +ED Sbjct: 21 RAKCKGCKEQ--IEKSSARIAKLAPNPFSEDGGLMKQWYHVKCIFDSFSRARATTKKIED 78 Query: 70 IEKDNEDVEMSSDDENVV---VDSEGGKK 95 E + V+M DD+N + + GKK Sbjct: 79 AEDLDGFVDMKQDDQNTIKQLISGLSGKK 107 >SB_3294| Best HMM Match : DUF755 (HMM E-Value=0.22) Length = 884 Score = 26.2 bits (55), Expect = 6.1 Identities = 24/90 (26%), Positives = 36/90 (40%), Gaps = 5/90 (5%) Query: 12 KCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIF-LDAGDLKKSKKV-LED 69 K R +K+ +K R +K L E E I D DL + V LED Sbjct: 478 KTRKLKK---IIKTRRRRRKHLDTSSSHDSYPGSNSEGEGTISGEDDSDLSEGGVVDLED 534 Query: 70 IEKDNEDVEMSSDDENVVVDSEGGKKRVFN 99 +D++DV + SD E + +F+ Sbjct: 535 ASEDSDDVYVESDSEEEGTEQSAEPVTIFS 564 >SB_39476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 343 Score = 25.8 bits (54), Expect = 8.1 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 9/70 (12%) Query: 40 KPAGSEVMESEQVIFLDAG----DLKKSKKVLE-DIEKDNEDVEMSSDDENVVVDSEGGK 94 KPA V Q +FLDA D K+ +++E +++ ++ D E ++D E DSE Sbjct: 239 KPAKCLVNTKCQPVFLDAFGKELDCKERGQIVENNLDDEDSDAEETADQE----DSEDSL 294 Query: 95 KRVFNTKTLK 104 R+ K K Sbjct: 295 SRLMKGKHQK 304 >SB_29236| Best HMM Match : TMS_TDE (HMM E-Value=0) Length = 834 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/43 (25%), Positives = 23/43 (53%) Query: 67 LEDIEKDNEDVEMSSDDENVVVDSEGGKKRVFNTKTLKDQNGQ 109 + D+++ E +S D + VD GG + + +T ++ +GQ Sbjct: 663 VNDVQEMKATQEYTSTDGDTSVDKSGGAESLTSTPGAREYDGQ 705 >SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3133 Score = 25.8 bits (54), Expect = 8.1 Identities = 23/81 (28%), Positives = 43/81 (53%), Gaps = 7/81 (8%) Query: 9 WKRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLE 68 +KR C A +R+ +V L LK+ L + ++ A S S Q F DA + ++SK V Sbjct: 276 YKRICNATERKIESVFLLPLLKQRLAEQGSDQAAHS----SRQ--FDDAQESQESKLVDS 329 Query: 69 DIEKDN-EDVEMSSDDENVVV 88 +++ D+ + ++ + V+V Sbjct: 330 EVKHDDTAEAGSQAEKQKVIV 350 >SB_3141| Best HMM Match : Vicilin_N (HMM E-Value=4.1) Length = 287 Score = 25.8 bits (54), Expect = 8.1 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 3/80 (3%) Query: 8 RWKRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSE-VMESEQVIFLDAGDLKKSKKV 66 R+ RK A++R +Y ++L +++LG E ESE + + Sbjct: 77 RFSRK--AVQRNKYLREKLGVPRQVLGYCPRFCTIREEDEEESEPQLKTKTDTYSSPSRN 134 Query: 67 LEDIEKDNEDVEMSSDDENV 86 + EK+N + + +SDDE+V Sbjct: 135 RDHAEKENYNCDENSDDEDV 154 >SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 25.8 bits (54), Expect = 8.1 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 1/75 (1%) Query: 34 GVKDEEKPAGSEVMESEQVIFLDA-GDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEG 92 G + + +G E+ +E+ A G ++ + ED + D++D E +DE+ D + Sbjct: 136 GKRQKSAGSGQEIQTTEEKTTESAEGSSEEEEMDDEDEDHDDDDEEEEEEDEDDDGDGDQ 195 Query: 93 GKKRVFNTKTLKDQN 107 K T D N Sbjct: 196 EIKGPIKTAEESDDN 210 >SB_54200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 996 Score = 25.8 bits (54), Expect = 8.1 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 9/86 (10%) Query: 24 KELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDD 83 KE K+ G K+EEK + + ++ + D G K K E EK+N+ ++ + Sbjct: 739 KEETDGKEDKGAKEEEKGSNEKDEKNTKGEEKDKGKEDKGKDGEERKEKENKHGKVEKGN 798 Query: 84 ENVVVDSEGGKKRVFNTKTLKDQNGQ 109 + D E GK+R K KD+NG+ Sbjct: 799 Q----DGE-GKER----KDEKDKNGE 815 >SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 25.8 bits (54), Expect = 8.1 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Query: 36 KDEEKPAGSEVMESEQVIFLDAGDL---KKSKKVLEDIEKDNEDVEMSSDDE 84 +DEEKP +SE V + D +S++ E+ E++ ED E+ D + Sbjct: 364 EDEEKPEHKPREDSEDVTSRTSSDFTLATESEEEEEEEEEEEEDDELIGDPD 415 >SB_50536| Best HMM Match : Mycobact_memb (HMM E-Value=5.3) Length = 462 Score = 25.8 bits (54), Expect = 8.1 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 7/81 (8%) Query: 9 WKRKCRAIKRERYAVKELARLKKMLGVKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLE 68 +KR C A +R+ +V L LK+ L + ++ A S S Q F DA + ++SK V Sbjct: 108 YKRICNATERKIESVFLLPLLKQRLAEQGSDQAAHS----SRQ--FDDAQESQESKSVDS 161 Query: 69 DIEKDN-EDVEMSSDDENVVV 88 ++ D+ + ++ + V+V Sbjct: 162 QVKHDDTAEAGSQAETQKVIV 182 >SB_46201| Best HMM Match : WD40 (HMM E-Value=0) Length = 292 Score = 25.8 bits (54), Expect = 8.1 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Query: 58 GDLKKSK----KVLEDIEKDNEDVEMSSDDENVVVDSEGGKKRVFNTKT 102 GD KK K K LE E + +SSD + +V SE R+++T+T Sbjct: 15 GDKKKDKTFLIKSLEHHEGGINAMCISSDGKTIVTGSEDKTGRLWDTRT 63 >SB_36817| Best HMM Match : rve (HMM E-Value=6.2e-36) Length = 924 Score = 25.8 bits (54), Expect = 8.1 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Query: 70 IEKDNEDVEMSSDDENVVVD-----SEGGKKRVFNTKTLKDQNGQYP 111 ++K+ E + S DE+V + SEGG+ F ++TL+ YP Sbjct: 430 LKKELESATLHSIDESVPFEVECDASEGGRPVAFMSRTLQGSKLHYP 476 >SB_36705| Best HMM Match : RRF (HMM E-Value=0.26) Length = 397 Score = 25.8 bits (54), Expect = 8.1 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Query: 35 VKDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDD 83 VK+ + E+ +SE+ I + DLK+S V E++ + +V DD Sbjct: 310 VKETGQSISKEIQDSEKSISKEIRDLKQS--VREEVIRPIHEVRQKLDD 356 >SB_32968| Best HMM Match : SRP40_C (HMM E-Value=0.013) Length = 440 Score = 25.8 bits (54), Expect = 8.1 Identities = 19/64 (29%), Positives = 28/64 (43%) Query: 36 KDEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKK 95 K E+K + SE+ D D K KK +K E SS+D++ + E KK Sbjct: 136 KVEKKTPTKQESSSEEDDSSDDKDEKPKKKADNKGKKTQAKQESSSEDDSSDEEDEKPKK 195 Query: 96 RVFN 99 + N Sbjct: 196 KADN 199 >SB_29732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 621 Score = 25.8 bits (54), Expect = 8.1 Identities = 18/62 (29%), Positives = 28/62 (45%) Query: 37 DEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKKR 96 DE K + E E+ + AG +K++ ++L EDVE V ++ GKK Sbjct: 65 DEYKVTATLSPEDEKSLEEFAGYVKETSRILRKGSVSLEDVEKREVSYVVSLEDNQGKKE 124 Query: 97 VF 98 F Sbjct: 125 RF 126 >SB_29730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4275 Score = 25.8 bits (54), Expect = 8.1 Identities = 18/62 (29%), Positives = 28/62 (45%) Query: 37 DEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIEKDNEDVEMSSDDENVVVDSEGGKKR 96 DE K + E E+ + AG +K++ ++L EDVE V ++ GKK Sbjct: 2791 DEYKVTATLSPEDEKSLEEFAGYVKETSRILRKGSVSLEDVEKREVSYVVSLEDNQGKKE 2850 Query: 97 VF 98 F Sbjct: 2851 RF 2852 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 25.8 bits (54), Expect = 8.1 Identities = 17/61 (27%), Positives = 36/61 (59%), Gaps = 4/61 (6%) Query: 16 IKRERYAVKE-LARLKKMLGVK---DEEKPAGSEVMESEQVIFLDAGDLKKSKKVLEDIE 71 +++ER +K+ + + K+ L K D E+ SE + E++I G+L K++ L+++E Sbjct: 1631 LEKEREGIKDNMDKYKRELFEKMKNDHEQDLTSERKKYEEIIEALQGELSKAEVRLKEVE 1690 Query: 72 K 72 + Sbjct: 1691 E 1691 >SB_8981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1726 Score = 25.8 bits (54), Expect = 8.1 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Query: 49 SEQVIF-LDAGDLKKSKKVLEDIEKDNED-VEMSSDDEN 85 S +++F D+ D KS V + +E DN+D VE+ S N Sbjct: 1426 SNELLFESDSNDESKSLTVNDGVENDNDDCVELGSTAAN 1464 >SB_8090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 25.8 bits (54), Expect = 8.1 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Query: 71 EKDNEDVEMSSDDENVVVDSEG---GKKRVFNTKTLKDQN 107 + +N+D +S DEN + +S+G +V T+ KD N Sbjct: 82 DNNNDDENSNSIDENSINNSQGCNNNNDKVVTTQQCKDDN 121 >SB_2546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 25.8 bits (54), Expect = 8.1 Identities = 9/23 (39%), Positives = 17/23 (73%) Query: 69 DIEKDNEDVEMSSDDENVVVDSE 91 D+ D++D ++ DD++VVVD + Sbjct: 181 DVVNDDDDNVVNDDDDDVVVDDD 203 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.309 0.128 0.343 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,856,167 Number of Sequences: 59808 Number of extensions: 153179 Number of successful extensions: 980 Number of sequences better than 10.0: 107 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 72 Number of HSP's that attempted gapping in prelim test: 895 Number of HSP's gapped (non-prelim): 160 length of query: 112 length of database: 16,821,457 effective HSP length: 73 effective length of query: 39 effective length of database: 12,455,473 effective search space: 485763447 effective search space used: 485763447 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -