BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001626-TA|BGIBMGA001626-PA|undefined (235 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42687| Best HMM Match : UPF0262 (HMM E-Value=2.1) 30 1.4 SB_30355| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) 30 1.4 SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) 30 1.4 SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_12499| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 30 1.9 SB_16070| Best HMM Match : IncA (HMM E-Value=0.43) 30 1.9 SB_47306| Best HMM Match : I-set (HMM E-Value=0) 29 2.5 SB_57683| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_25687| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_53685| Best HMM Match : bZIP_2 (HMM E-Value=0.99) 29 3.3 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 29 3.3 SB_32858| Best HMM Match : DUF59 (HMM E-Value=6.4) 29 4.4 SB_32248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_48444| Best HMM Match : Death (HMM E-Value=2.1e-16) 29 4.4 SB_38936| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_57874| Best HMM Match : LIM (HMM E-Value=0.44) 28 5.8 SB_52975| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_22559| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_20530| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_5396| Best HMM Match : DEAD (HMM E-Value=0.73) 28 5.8 SB_35740| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_17392| Best HMM Match : DUF385 (HMM E-Value=1.1) 28 5.8 SB_5569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_31699| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) 28 7.7 SB_23543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) 28 7.7 SB_24707| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_12405| Best HMM Match : I-set (HMM E-Value=8.8e-21) 28 7.7 SB_11642| Best HMM Match : LIM (HMM E-Value=1.4) 28 7.7 >SB_42687| Best HMM Match : UPF0262 (HMM E-Value=2.1) Length = 908 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/56 (21%), Positives = 29/56 (51%) Query: 97 LTDVLCNGESVLASGRITVIPGKLISFNFPSFEDTNACVYLGVFKKDDRLYKKILA 152 + + + ES + + ++ + GK+ +F + C G+ KD++L +++LA Sbjct: 833 IVETINRAESKILTAKLDPLTGKIALMRCVAFLNAELCALFGLEAKDNQLVERVLA 888 >SB_30355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1067 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/37 (32%), Positives = 21/37 (56%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC + C+ SV S R+ I G++ Sbjct: 903 FESDYRCLCEDCGIPYSTCDCGSVAPSSRLHDIKGRI 939 >SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 1042 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/37 (32%), Positives = 20/37 (54%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC +CN S S R+ I G++ Sbjct: 851 FESDYRCLCEDCGKPYSICNCGSAAPSSRLHDIKGRI 887 >SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 1053 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/37 (32%), Positives = 20/37 (54%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDCE C+ S S R+ I G++ Sbjct: 595 FESDYRCLCEDCEKPYSTCDRGSAAPSSRLHDIKGRI 631 >SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/37 (32%), Positives = 20/37 (54%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDCE C+ S S R+ I G++ Sbjct: 533 FESDYRCLCEDCEKPYSTCDRGSAAPSSRLHDIKGRI 569 >SB_12499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 470 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Query: 199 RITEYSNAYEGVYQAVFST---SEGPVTKNILE 228 ++ Y++A GV+ AVF+T +EGP K+ILE Sbjct: 96 KVATYASAAFGVFGAVFATVGFAEGPTPKDILE 128 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Query: 18 SRYSLRSYSDPQKFIVLDLEGTRPQDFGDYFAVLENEDGNEERIKALTI 66 SR+S + P VL + G P D G Y + N G ++ + LT+ Sbjct: 2440 SRFSFETR--PGDVCVLTIRGVTPDDEGSYKCIATNPAGQDDTVAELTV 2486 >SB_16070| Best HMM Match : IncA (HMM E-Value=0.43) Length = 895 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDCE C+ S S R+ I G++ Sbjct: 429 FESDYRCLCEDCEKPYSTCDCGSAAPSSRLHDIKGRI 465 >SB_47306| Best HMM Match : I-set (HMM E-Value=0) Length = 1260 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Query: 9 DGTVANLDPSRYSLRSYSDPQKFIVLDLEGTRPQDFGDYFAVLENEDGNEERIKALTIK 67 DG V D R+ +P+ F ++ ++ +P+D G Y + NE G E L+IK Sbjct: 585 DGKVVE-DAGRFLYVEDEEPEVFSLV-IDDVQPEDAGKYKCIAFNEKGEVEAEANLSIK 641 >SB_57683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/37 (29%), Positives = 21/37 (56%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC +C+ S + S R+ I G++ Sbjct: 104 FESDYRCLCEDCGKPYSICDCGSAVPSSRLHDIKGRI 140 >SB_25687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 877 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC CN S S R+ I G++ Sbjct: 558 FESDYRCLCEDCGKPYSTCNCGSAAPSSRLHDIKGRI 594 >SB_53685| Best HMM Match : bZIP_2 (HMM E-Value=0.99) Length = 716 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/71 (22%), Positives = 32/71 (45%) Query: 50 VLENEDGNEERIKALTIKLLKASRLKTASKVGDHYDTTVQCTCEDCELTDVLCNGESVLA 109 + E E +E +I+ + + + A +++ +C CEDC C+ +S Sbjct: 262 ITEEEGRSEHKIEGAKSQSVPWKASEWAQGNIRWFESDYRCLCEDCGKPYSTCDCDSAAP 321 Query: 110 SGRITVIPGKL 120 S R+ I G++ Sbjct: 322 SSRLHDIKGRI 332 >SB_8817| Best HMM Match : I-set (HMM E-Value=0) Length = 2526 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/51 (25%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Query: 16 DPSRYSLRSYSDPQKFIVLDLEGTRPQDFGDYFAVLENEDGNEERIKALTI 66 D R+ + + D I+ D+ +P D G+Y ++ N+ G + + LT+ Sbjct: 1300 DTGRFLINTEEDTSTLIIEDV---KPIDKGNYKCIISNDAGEDMTVSKLTV 1347 >SB_32858| Best HMM Match : DUF59 (HMM E-Value=6.4) Length = 235 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Query: 22 LRSYSDPQKFIVLDLEGTRPQDFGDYFAVLENED 55 L +Y DP+K+IV DL GT FG + + +D Sbjct: 137 LGNYLDPEKYIVTDLLGT--GGFGKVYLCMRKDD 168 >SB_32248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +D+ +C CEDC C+ S S R+ I G++ Sbjct: 895 FDSDYRCLCEDCGKPYSTCDCGSAAPSSRLHDIKGRI 931 >SB_48444| Best HMM Match : Death (HMM E-Value=2.1e-16) Length = 486 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Query: 22 LRSYSDPQKFIVLDLEGTRPQDFGDYFAVLENED 55 L +Y DP+K+IV DL GT FG + + +D Sbjct: 322 LGNYLDPEKYIVTDLLGT--GGFGKVYLCMRKDD 353 >SB_38936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/37 (29%), Positives = 20/37 (54%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC C+ +S S R+ I G++ Sbjct: 112 FESDYRCLCEDCGKPYSTCDCDSAAPSSRLHDIKGRI 148 >SB_57874| Best HMM Match : LIM (HMM E-Value=0.44) Length = 1037 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC C+ S S R+ I G++ Sbjct: 769 FESDYRCLCEDCGKPYSTCDCGSAAPSSRLHAIKGRI 805 >SB_52975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC C+ S S R+ I GK+ Sbjct: 648 FESDYRCLCEDCGKPYSTCDCGSAAPSSRLHDIKGKI 684 >SB_22559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 944 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/37 (29%), Positives = 20/37 (54%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC +C+ S S R+ I G++ Sbjct: 743 FESDYRCLCEDCGKPYSICDCGSAAPSSRLHDIKGRI 779 >SB_20530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC C+ S S R+ I G++ Sbjct: 440 FESDYRCLCEDCGKPYSTCDCGSAAPSSRLHAIKGRI 476 >SB_5396| Best HMM Match : DEAD (HMM E-Value=0.73) Length = 1017 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC C+ S S R+ I G++ Sbjct: 842 FESDYRCLCEDCGKPYSTCDCGSAAPSSRLHAIKGRI 878 >SB_35740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Query: 70 KASRLKTASKVGDHYDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 K RL + + +D +C CEDC CN S S R+ I G++ Sbjct: 737 KLDRLAEVIIIDECFD--YRCLCEDCGKPYSTCNCGSAAPSSRLHDIKGRI 785 >SB_17392| Best HMM Match : DUF385 (HMM E-Value=1.1) Length = 942 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC C+ S S R+ I GK+ Sbjct: 807 FESDYRCLCEDCGKPYSTCDCGSAAPSSRLHDIKGKI 843 >SB_5569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/46 (28%), Positives = 20/46 (43%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKLISFNFPSFE 129 +++ +C CEDC C+ S S R+ I G+ P E Sbjct: 507 FESDYRCLCEDCGKAYSTCDCGSAAPSSRLHDIKGRFGVSQIPKLE 552 >SB_31699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6119 Score = 27.9 bits (59), Expect = 7.7 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Query: 16 DPSRYSLRSYSDPQ-KFIVLDLEGTRPQDFGDYFAVLENEDGNEERIKALTI 66 D R+++ SD I+ DLE T D G Y V NE G E + LT+ Sbjct: 437 DGERFTIAEESDEVFSLIIQDLEET---DAGRYKCVATNEAGEAESMAQLTV 485 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Query: 16 DPSRYSLRSYSDPQKFIVLDLEGTRPQDFGDYFAVLENEDG 56 D RYS+ + VL + TRP+D G+Y + N G Sbjct: 2102 DGGRYSI--VEEENGLFVLTIRNTRPEDAGEYQCIAVNGAG 2140 >SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) Length = 984 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC C+ S S R+ I G++ Sbjct: 664 FESDYRCLCEDCRKPYSTCDCGSAAPSSRLHDIKGRI 700 >SB_23543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 869 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC C+ S S R+ I G++ Sbjct: 549 FESDYRCLCEDCRKPYSTCDCGSAAPSSRLHDIKGRI 585 >SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1143 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC C+ S S R+ I G++ Sbjct: 836 FESDYRCLCEDCGKPYSTCDCGSAAPSSRLNDIKGRI 872 >SB_24707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 921 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC C+ S S R+ I G++ Sbjct: 727 FESDYRCLCEDCRKPYSTCDCGSAAPSSRLHDIKGRI 763 >SB_12405| Best HMM Match : I-set (HMM E-Value=8.8e-21) Length = 198 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Query: 16 DPSRYSLRSYSDPQKFIVLDLEGTRPQDFGDYFAVLENEDG 56 D RYS+ + VL + TRP+D G+Y + N G Sbjct: 30 DGGRYSI--VEEENGLFVLTIRNTRPEDAGEYQCIAVNGAG 68 >SB_11642| Best HMM Match : LIM (HMM E-Value=1.4) Length = 906 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 84 YDTTVQCTCEDCELTDVLCNGESVLASGRITVIPGKL 120 +++ +C CEDC C+ S S R+ I G++ Sbjct: 712 FESDYRCLCEDCRKPYSTCDCGSAAPSSRLHNIKGRI 748 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,152,080 Number of Sequences: 59808 Number of extensions: 257020 Number of successful extensions: 757 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 715 Number of HSP's gapped (non-prelim): 54 length of query: 235 length of database: 16,821,457 effective HSP length: 80 effective length of query: 155 effective length of database: 12,036,817 effective search space: 1865706635 effective search space used: 1865706635 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -