BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001622-TA|BGIBMGA001622-PA|undefined (279 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00006A2711 Cluster: UPI00006A2711 related cluster; n... 33 8.0 >UniRef50_UPI00006A2711 Cluster: UPI00006A2711 related cluster; n=2; Xenopus tropicalis|Rep: UPI00006A2711 UniRef100 entry - Xenopus tropicalis Length = 234 Score = 33.1 bits (72), Expect = 8.0 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 8/83 (9%) Query: 39 SYDNGYDDIANVISYYRLNNAQTDIENIFKKHTKGKGIKALTG------SHRLIAQAIWD 92 S D G +A + +YY+ +T + ++T G+ IKALTG S +L+ + D Sbjct: 107 SEDPGVKSVAKIYNYYKKFGYKTIVMGASFRNT-GE-IKALTGCDYLTISPKLLGELAKD 164 Query: 93 LSKLFSLLTVLGALANGYRTGHL 115 SKL +LTV A A+ HL Sbjct: 165 SSKLTPVLTVKEAQASNLEKVHL 187 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.315 0.134 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,477,392 Number of Sequences: 1657284 Number of extensions: 6938593 Number of successful extensions: 11953 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 11953 Number of HSP's gapped (non-prelim): 1 length of query: 279 length of database: 575,637,011 effective HSP length: 100 effective length of query: 179 effective length of database: 409,908,611 effective search space: 73373641369 effective search space used: 73373641369 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 72 (33.1 bits)
- SilkBase 1999-2023 -