BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001622-TA|BGIBMGA001622-PA|undefined (279 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0618 + 30400338-30400452,30400553-30400692,30400805-304010... 29 4.1 06_01_0557 - 3959122-3959689,3960084-3960280,3960882-3961082,396... 28 9.6 >02_05_0618 + 30400338-30400452,30400553-30400692,30400805-30401044, 30401157-30401693 Length = 343 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 8 DGRGNHDQGIKVIIDDKGICRSDFGKHYGWRSYDNGYDDIANVISYYRLN 57 DG G+ D+G DD G+ +D G H+ + D+ +D + ++ N Sbjct: 295 DGAGS-DEGCSYYADDAGVLFADHGHHHHHQHADDDEEDGQQISCWWMWN 343 >06_01_0557 - 3959122-3959689,3960084-3960280,3960882-3961082, 3962300-3962383,3962667-3962783 Length = 388 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/29 (34%), Positives = 19/29 (65%) Query: 14 DQGIKVIIDDKGICRSDFGKHYGWRSYDN 42 D G + ++D +C +D K++G++S DN Sbjct: 99 DIGGRQYMEDTHVCITDLAKNFGYQSVDN 127 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.315 0.134 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,898,930 Number of Sequences: 37544 Number of extensions: 176864 Number of successful extensions: 238 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 236 Number of HSP's gapped (non-prelim): 2 length of query: 279 length of database: 14,793,348 effective HSP length: 81 effective length of query: 198 effective length of database: 11,752,284 effective search space: 2326952232 effective search space used: 2326952232 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -