BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001622-TA|BGIBMGA001622-PA|undefined (279 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_806| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_6883| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 >SB_806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/60 (26%), Positives = 29/60 (48%) Query: 13 HDQGIKVIIDDKGICRSDFGKHYGWRSYDNGYDDIANVISYYRLNNAQTDIENIFKKHTK 72 +D+ I++ I DK I + KH Y+N Y + + +Y + T +I+ KH + Sbjct: 109 YDKHIRIHIYDKHIRVHIYDKHIRVHIYNNTYVYTSTINTYVYTSTTNTYGVHIYDKHMR 168 >SB_6883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Query: 16 GIKVIIDDKGICRSDFGKHYGWRSYDNGYD 45 G K + ++KG+C+S F Y +D Y+ Sbjct: 848 GCKDVCNEKGVCKSFFRSDYAVECFDEKYN 877 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.134 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,839,749 Number of Sequences: 59808 Number of extensions: 208510 Number of successful extensions: 278 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 275 Number of HSP's gapped (non-prelim): 3 length of query: 279 length of database: 16,821,457 effective HSP length: 81 effective length of query: 198 effective length of database: 11,977,009 effective search space: 2371447782 effective search space used: 2371447782 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -