BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001622-TA|BGIBMGA001622-PA|undefined (279 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY460911-1|AAR84884.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460892-1|AAR84865.1| 49|Drosophila melanogaster epidermal gr... 29 9.4 AY460891-1|AAR84864.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460882-1|AAR84855.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460879-1|AAR84852.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460878-1|AAR84851.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460858-1|AAR84834.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460854-1|AAR84830.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460853-1|AAR84829.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460851-1|AAR84827.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460848-1|AAR84824.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460826-1|AAR84802.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460823-1|AAR84799.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460816-1|AAR84792.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460813-1|AAR84789.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460810-1|AAR84786.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460779-1|AAR84756.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460771-1|AAR84748.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460761-1|AAR84738.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460757-1|AAR84734.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460755-1|AAR84732.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460754-1|AAR84731.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460729-1|AAR84706.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 AY460727-1|AAR84704.1| 51|Drosophila melanogaster epidermal gr... 29 9.4 >AY460911-1|AAR84884.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460892-1|AAR84865.1| 49|Drosophila melanogaster epidermal growth factor receptor protein. Length = 49 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 8 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 41 >AY460891-1|AAR84864.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460882-1|AAR84855.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460879-1|AAR84852.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460878-1|AAR84851.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460858-1|AAR84834.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460854-1|AAR84830.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460853-1|AAR84829.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460851-1|AAR84827.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460848-1|AAR84824.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460826-1|AAR84802.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460823-1|AAR84799.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460816-1|AAR84792.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460813-1|AAR84789.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460810-1|AAR84786.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460779-1|AAR84756.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460771-1|AAR84748.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460761-1|AAR84738.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460757-1|AAR84734.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460755-1|AAR84732.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460754-1|AAR84731.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460729-1|AAR84706.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 >AY460727-1|AAR84704.1| 51|Drosophila melanogaster epidermal growth factor receptor protein. Length = 51 Score = 28.7 bits (61), Expect = 9.4 Identities = 10/34 (29%), Positives = 23/34 (67%) Query: 86 IAQAIWDLSKLFSLLTVLGALANGYRTGHLSHCG 119 I++ +WD+S ++S+L +L +A+ + +S+ G Sbjct: 10 ISRGLWDISSIWSVLLILACMASITTSSSVSNAG 43 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.315 0.134 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,290,176 Number of Sequences: 52641 Number of extensions: 301074 Number of successful extensions: 534 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 510 Number of HSP's gapped (non-prelim): 24 length of query: 279 length of database: 24,830,863 effective HSP length: 84 effective length of query: 195 effective length of database: 20,409,019 effective search space: 3979758705 effective search space used: 3979758705 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -