GeneModel BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001622-TA|BGIBMGA001622-PA|undefined
         (279 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g03260.1 68417.m00445 leucine-rich repeat family protein cont...    28   8.0  

>At4g03260.1 68417.m00445 leucine-rich repeat family protein
           contains leucine rich repeat (LRR) domains, Pfam:PF00560
          Length = 677

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 1/57 (1%)

Query: 55  RLNNAQTDIENIFKKHTKGKGIKALTGSHRLIAQAIWDLS-KLFSLLTVLGALANGY 110
           RL +      ++ + +  G  I  + G HRL+   + DL    FS    LG LA  Y
Sbjct: 477 RLGHGLASCSSLKELYLAGNKISEIEGLHRLLKLTVLDLRFNKFSTTKCLGQLAANY 533


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.315    0.134    0.400 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,098,716
Number of Sequences: 28952
Number of extensions: 151005
Number of successful extensions: 231
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 231
Number of HSP's gapped (non-prelim): 1
length of query: 279
length of database: 12,070,560
effective HSP length: 80
effective length of query: 199
effective length of database: 9,754,400
effective search space: 1941125600
effective search space used: 1941125600
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 59 (27.9 bits)