GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001619-TA|BGIBMGA001619-PA|IPR000504|RNA-binding region
RNP-1 (RNA recognition motif), IPR003954|RNA recognition, region 1
         (246 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.           24   4.7  

>CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.
          Length = 1664

 Score = 23.8 bits (49), Expect = 4.7
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 19  KPPAPKNELNSKPLTFDEVYNQSSASNCTVY 49
           +PPA    L+   +  D+  NQSS +  T+Y
Sbjct: 404 RPPACSTRLHCTMIRHDDDSNQSSGTCYTLY 434


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.315    0.131    0.416 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 231,021
Number of Sequences: 2123
Number of extensions: 8055
Number of successful extensions: 14
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 13
Number of HSP's gapped (non-prelim): 1
length of query: 246
length of database: 516,269
effective HSP length: 62
effective length of query: 184
effective length of database: 384,643
effective search space: 70774312
effective search space used: 70774312
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 47 (23.0 bits)