BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001617-TA|BGIBMGA001617-PA|undefined (269 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.9 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 86 EPKNSRDENDPNISEAGEMVKLVASNDCKSTVN 118 +PKNS+D N + + +++ A D KS N Sbjct: 518 KPKNSQDNNISLLEQQKIPLRMTAGIDPKSIFN 550 Score = 22.6 bits (46), Expect = 3.8 Identities = 11/47 (23%), Positives = 20/47 (42%) Query: 145 VVNKRQSAMPSCDCSNKQSDVPECACQSKSIENGVRDNVTERKIEKP 191 ++ R+ D K++ A + +I G DN + K +KP Sbjct: 1085 LMRPRKRDQKQSDDKTKETSTVTAAAAATNIRPGTADNKPQLKPQKP 1131 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.313 0.127 0.375 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,580 Number of Sequences: 429 Number of extensions: 3057 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 269 length of database: 140,377 effective HSP length: 57 effective length of query: 212 effective length of database: 115,924 effective search space: 24575888 effective search space used: 24575888 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -