BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001616-TA|BGIBMGA001616-PA|IPR006073|GTP1/OBG, IPR002917|GTP-binding protein, HSR1-related, IPR005289|GTP-binding (516 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 6.1 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 8.0 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.0 bits (47), Expect = 6.1 Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 175 YAGMMFPPSLYEYIVKDQHKNMIVVMNKIDLVP 207 + GM+ L E +VK+ K + +MN+ VP Sbjct: 678 WKGMLSEKILAEPLVKEHFKKALELMNRAVSVP 710 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.6 bits (46), Expect = 8.0 Identities = 26/77 (33%), Positives = 33/77 (42%), Gaps = 13/77 (16%) Query: 52 RGGRDTNRYALKFYRETEDELKIKKEDALRALSPVPEKEMEINSLDYFP-VDLSFPRRPP 110 RG D ++ L+ +T D+LKIK L VPE S D P V LS P R P Sbjct: 95 RGEIDVSQAELQSLLKTADQLKIK------GLCEVPE------SRDGPPSVSLSSPPREP 142 Query: 111 WDFNMTAAQLDAQEHRY 127 + +L RY Sbjct: 143 GTPRINFTKLKRHHPRY 159 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.135 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,963 Number of Sequences: 429 Number of extensions: 6622 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 2 length of query: 516 length of database: 140,377 effective HSP length: 61 effective length of query: 455 effective length of database: 114,208 effective search space: 51964640 effective search space used: 51964640 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -