BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001616-TA|BGIBMGA001616-PA|IPR006073|GTP1/OBG, IPR002917|GTP-binding protein, HSR1-related, IPR005289|GTP-binding (516 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 23 5.1 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 23 6.7 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 23.0 bits (47), Expect = 5.1 Identities = 10/41 (24%), Positives = 21/41 (51%) Query: 194 KNMIVVMNKIDLVPAGVVAAWKEYFVEKYPGLRVVYFTSCP 234 ++++ ++N +P+ V + YF+ YP L + S P Sbjct: 326 EHILSIVNTCSQIPSEVEDKYTTYFLNTYPHLFNFFEFSVP 366 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 22.6 bits (46), Expect = 6.7 Identities = 7/14 (50%), Positives = 7/14 (50%) Query: 423 RIEHPDNEDTWSPW 436 R E P E W PW Sbjct: 236 RCEEPTEEKPWRPW 249 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,734 Number of Sequences: 317 Number of extensions: 5118 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 516 length of database: 114,650 effective HSP length: 60 effective length of query: 456 effective length of database: 95,630 effective search space: 43607280 effective search space used: 43607280 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -