BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001613-TA|BGIBMGA001613-PA|IPR001937|Galactose-1- phosphate uridyl transferase, class I, IPR011573|Galactose-1-phosphate uridyl transferase, IPR005849|Galactose-1-phosphate uridyl transferase, N-terminal, IPR005850|Galactose-1-phosphate uridyl transferase, C-terminal (378 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 24 1.6 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 24 1.6 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 24 1.6 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 24 1.6 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 24 1.6 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 24 1.6 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 24 1.6 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 24 1.6 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 24 1.6 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 24 2.1 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 8.3 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 8.3 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 1.6 Identities = 13/39 (33%), Positives = 17/39 (43%) Query: 59 PWSGQTEAAPEDQPPDPNNPLRAGALRSSGKRNPDYTST 97 P T AP P + P + A +SSG +P ST Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVST 151 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 1.6 Identities = 13/39 (33%), Positives = 17/39 (43%) Query: 59 PWSGQTEAAPEDQPPDPNNPLRAGALRSSGKRNPDYTST 97 P T AP P + P + A +SSG +P ST Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVST 151 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 24.2 bits (50), Expect = 1.6 Identities = 13/39 (33%), Positives = 17/39 (43%) Query: 59 PWSGQTEAAPEDQPPDPNNPLRAGALRSSGKRNPDYTST 97 P T AP P + P + A +SSG +P ST Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVST 151 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 1.6 Identities = 13/39 (33%), Positives = 17/39 (43%) Query: 59 PWSGQTEAAPEDQPPDPNNPLRAGALRSSGKRNPDYTST 97 P T AP P + P + A +SSG +P ST Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVST 151 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 24.2 bits (50), Expect = 1.6 Identities = 13/39 (33%), Positives = 17/39 (43%) Query: 59 PWSGQTEAAPEDQPPDPNNPLRAGALRSSGKRNPDYTST 97 P T AP P + P + A +SSG +P ST Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVST 151 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 24.2 bits (50), Expect = 1.6 Identities = 13/39 (33%), Positives = 17/39 (43%) Query: 59 PWSGQTEAAPEDQPPDPNNPLRAGALRSSGKRNPDYTST 97 P T AP P + P + A +SSG +P ST Sbjct: 69 PQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVST 107 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 24.2 bits (50), Expect = 1.6 Identities = 13/39 (33%), Positives = 17/39 (43%) Query: 59 PWSGQTEAAPEDQPPDPNNPLRAGALRSSGKRNPDYTST 97 P T AP P + P + A +SSG +P ST Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVST 151 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 24.2 bits (50), Expect = 1.6 Identities = 13/39 (33%), Positives = 17/39 (43%) Query: 59 PWSGQTEAAPEDQPPDPNNPLRAGALRSSGKRNPDYTST 97 P T AP P + P + A +SSG +P ST Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVST 151 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 24.2 bits (50), Expect = 1.6 Identities = 13/39 (33%), Positives = 17/39 (43%) Query: 59 PWSGQTEAAPEDQPPDPNNPLRAGALRSSGKRNPDYTST 97 P T AP P + P + A +SSG +P ST Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVST 151 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 23.8 bits (49), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 285 MKQLNTKYDNLFECSFPYSMGWHGAPTGPGTTRGDS 320 +KQ+N + L + P S+ AP GP T RG S Sbjct: 98 VKQVNNGFATLRQ-HIPASVAAAFAPQGPSTGRGAS 132 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.8 bits (44), Expect = 8.3 Identities = 13/50 (26%), Positives = 20/50 (40%) Query: 163 LNELGQRYTWVQIFENKGAIMGCSNPHPHCQIWASSFLPNEPRIKDRCQS 212 +N R V+ N +M +PH Q S + EP +D+ S Sbjct: 6 MNSACMRGGSVRTLNNYQQVMEPRSPHTAWQFGVSQIVKREPMDEDKNDS 55 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.8 bits (44), Expect = 8.3 Identities = 9/29 (31%), Positives = 15/29 (51%) Query: 68 PEDQPPDPNNPLRAGALRSSGKRNPDYTS 96 P+D P D + S G++N +Y+S Sbjct: 63 PQDSPYDASVAAACKLYSSEGQQNSNYSS 91 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.444 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,547 Number of Sequences: 317 Number of extensions: 3684 Number of successful extensions: 17 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 12 length of query: 378 length of database: 114,650 effective HSP length: 58 effective length of query: 320 effective length of database: 96,264 effective search space: 30804480 effective search space used: 30804480 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -