BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001613-TA|BGIBMGA001613-PA|IPR001937|Galactose-1-
phosphate uridyl transferase, class I, IPR011573|Galactose-1-phosphate
uridyl transferase, IPR005849|Galactose-1-phosphate uridyl
transferase, N-terminal, IPR005850|Galactose-1-phosphate uridyl
transferase, C-terminal
(378 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 26 1.5
>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
Length = 3398
Score = 26.2 bits (55), Expect = 1.5
Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 2/55 (3%)
Query: 18 YSHYTSATCECIERELHEHQHIRYNPLKDEWVLVSPHRCL--RPWSGQTEAAPED 70
Y H S C E + + I+Y P K+ W + R W ++ ED
Sbjct: 498 YPHLDSVDCWSFEIDGFKQATIKYYPSKERWEMTMEDRTFVYGAWENLSKRREED 552
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.320 0.135 0.444
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 400,569
Number of Sequences: 2123
Number of extensions: 15967
Number of successful extensions: 19
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 18
Number of HSP's gapped (non-prelim): 1
length of query: 378
length of database: 516,269
effective HSP length: 65
effective length of query: 313
effective length of database: 378,274
effective search space: 118399762
effective search space used: 118399762
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 49 (23.8 bits)
- SilkBase 1999-2023 -