GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001613-TA|BGIBMGA001613-PA|IPR001937|Galactose-1-
phosphate uridyl transferase, class I, IPR011573|Galactose-1-phosphate
uridyl transferase, IPR005849|Galactose-1-phosphate uridyl
transferase, N-terminal, IPR005850|Galactose-1-phosphate uridyl
transferase, C-terminal
         (378 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            26   1.5  

>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 26.2 bits (55), Expect = 1.5
 Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 2/55 (3%)

Query: 18  YSHYTSATCECIERELHEHQHIRYNPLKDEWVLVSPHRCL--RPWSGQTEAAPED 70
           Y H  S  C   E +  +   I+Y P K+ W +    R      W   ++   ED
Sbjct: 498 YPHLDSVDCWSFEIDGFKQATIKYYPSKERWEMTMEDRTFVYGAWENLSKRREED 552


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.320    0.135    0.444 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 400,569
Number of Sequences: 2123
Number of extensions: 15967
Number of successful extensions: 19
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 18
Number of HSP's gapped (non-prelim): 1
length of query: 378
length of database: 516,269
effective HSP length: 65
effective length of query: 313
effective length of database: 378,274
effective search space: 118399762
effective search space used: 118399762
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 49 (23.8 bits)