BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001611-TA|BGIBMGA001611-PA|undefined (330 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 30 0.027 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 2.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 4.1 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 22 7.1 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 22 7.1 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 29.9 bits (64), Expect = 0.027 Identities = 24/88 (27%), Positives = 36/88 (40%), Gaps = 8/88 (9%) Query: 163 TTKQEASTTKPLEATNVYQTTRSVPESSTAPTKT---NPAETATPKSNIKTVPTTPEINK 219 TT + +P + T V + +SVP S ++P + N E K N+ + K Sbjct: 203 TTYSFTADFRPPQETPVLASYKSVPMSFSSPRRRHSINLLEEDNQKPNVCRI-----CGK 257 Query: 220 DKCTPQTEKNEHADGSSTEPNRTVPCNK 247 P T K S +P R + CNK Sbjct: 258 SYARPSTLKTHLRTHSGEKPYRCIDCNK 285 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 23.4 bits (48), Expect = 2.3 Identities = 20/92 (21%), Positives = 37/92 (40%), Gaps = 5/92 (5%) Query: 225 QTEKNEHADGSSTEPNRTVPCNKPPAGPGQKEPATDLQPTPPGTGGKLALNQGKKE-IMQ 283 Q ++N+ A ++T P + PA + PTP + +N K+ MQ Sbjct: 187 QQQQNKSASRTTTSPTKVKASKASPAAAPRSVATPTGIPTPSTSASPPTVNIKKESPQMQ 246 Query: 284 ALETSMNLKVLILPNGPQGQNCFCTCDNTSAP 315 + + N I P+G + T +++P Sbjct: 247 SYRPTGN----ITPHGSNTSSLITTPSPSASP 274 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 4.1 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Query: 218 NKDKCTPQTEKNEHADGSSTEPNRTVPC--NKPPAGPGQKEPATD 260 NKD C H D SST T P +KP + TD Sbjct: 2272 NKDHCDWPENTECHPDASSTMAPSTTPMVPDKPVTTTTSRPIGTD 2316 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/29 (34%), Positives = 12/29 (41%) Query: 219 KDKCTPQTEKNEHADGSSTEPNRTVPCNK 247 K P T K S +P R + CNK Sbjct: 1 KSYARPSTLKTHLRTHSGEKPYRCIDCNK 29 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 234 GSSTEPNRTVPCNKPPAGP 252 GS T+P +TV +K P P Sbjct: 34 GSITQPTKTVIQSKRPLAP 52 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.302 0.121 0.338 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,377 Number of Sequences: 317 Number of extensions: 3231 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 330 length of database: 114,650 effective HSP length: 57 effective length of query: 273 effective length of database: 96,581 effective search space: 26366613 effective search space used: 26366613 T: 11 A: 40 X1: 17 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -