BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001608-TA|BGIBMGA001608-PA|IPR007754|N- acetylglucosaminyltransferase II (396 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 6.7 DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory pro... 22 8.8 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 22.2 bits (45), Expect = 6.7 Identities = 12/32 (37%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Query: 71 PY-SIQTHPNEFPGLDPNDCPRDVKMQQAIKL 101 PY S Q H + P D P D + A KL Sbjct: 47 PYASSQHHHHHLQARPPQDSPYDASVAAACKL 78 >DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory protein 8 protein. Length = 99 Score = 21.8 bits (44), Expect = 8.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Query: 116 REAKYTQTKHHWWWKA 131 R A+Y QTKH W A Sbjct: 77 RIARYVQTKHPDVWNA 92 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.134 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,851 Number of Sequences: 317 Number of extensions: 4326 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 396 length of database: 114,650 effective HSP length: 58 effective length of query: 338 effective length of database: 96,264 effective search space: 32537232 effective search space used: 32537232 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -