BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001605-TA|BGIBMGA001605-PA|undefined (49 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 22 2.5 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 20 7.5 AY825876-1|AAV70439.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825875-1|AAV70438.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825874-1|AAV70437.1| 162|Anopheles gambiae voltage gated sodi... 20 7.5 AY825873-1|AAV70436.1| 162|Anopheles gambiae voltage gated sodi... 20 7.5 AY825872-1|AAV70435.1| 162|Anopheles gambiae voltage gated sodi... 20 7.5 AY825871-1|AAV70434.1| 162|Anopheles gambiae voltage gated sodi... 20 7.5 AY825870-1|AAV70433.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825869-1|AAV70432.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825868-1|AAV70431.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825867-1|AAV70430.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825866-1|AAV70429.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825865-1|AAV70428.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825862-1|AAV70425.1| 162|Anopheles gambiae voltage gated sodi... 20 7.5 AY825861-1|AAV70424.1| 162|Anopheles gambiae voltage gated sodi... 20 7.5 AY825860-1|AAV70423.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825859-1|AAV70422.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825858-1|AAV70421.1| 162|Anopheles gambiae voltage gated sodi... 20 7.5 AY825857-1|AAV70420.1| 162|Anopheles gambiae voltage gated sodi... 20 7.5 AY825856-1|AAV70419.1| 166|Anopheles gambiae voltage gated sodi... 20 7.5 AY825855-1|AAV70418.1| 166|Anopheles gambiae voltage gated sodi... 20 7.5 AY825854-1|AAV70417.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825853-1|AAV70416.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825852-1|AAV70415.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825851-1|AAV70414.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825850-1|AAV70413.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825849-1|AAV70412.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825848-1|AAV70411.1| 160|Anopheles gambiae voltage gated sodi... 20 7.5 AY825847-1|AAV70410.1| 160|Anopheles gambiae voltage gated sodi... 20 7.5 AY825846-1|AAV70409.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825845-1|AAV70408.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825844-1|AAV70407.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825843-1|AAV70406.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825842-1|AAV70405.1| 160|Anopheles gambiae voltage gated sodi... 20 7.5 AY825841-1|AAV70404.1| 160|Anopheles gambiae voltage gated sodi... 20 7.5 AY825840-1|AAV70403.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825839-1|AAV70402.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825838-1|AAV70401.1| 162|Anopheles gambiae voltage gated sodi... 20 7.5 AY825837-1|AAV70400.1| 162|Anopheles gambiae voltage gated sodi... 20 7.5 AY825836-1|AAV70399.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825835-1|AAV70398.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825834-1|AAV70397.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 AY825833-1|AAV70396.1| 161|Anopheles gambiae voltage gated sodi... 20 7.5 CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 20 9.9 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 21.8 bits (44), Expect = 2.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 5 SFIGQVQSNPVIEDKGSQ 22 SF G+V+SNP + + Q Sbjct: 2014 SFYGEVESNPDVRYRSQQ 2031 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/32 (25%), Positives = 15/32 (46%) Query: 8 GQVQSNPVIEDKGSQIVLHMQEIYSQARADVH 39 G +++ + S + LH+ + A A VH Sbjct: 484 GAIENAHSVHAANSNMGLHLNNLLCDAEATVH 515 >AY825876-1|AAV70439.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825875-1|AAV70438.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825874-1|AAV70437.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825873-1|AAV70436.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825872-1|AAV70435.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825871-1|AAV70434.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825870-1|AAV70433.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825869-1|AAV70432.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825868-1|AAV70431.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825867-1|AAV70430.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825866-1|AAV70429.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825865-1|AAV70428.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825862-1|AAV70425.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825861-1|AAV70424.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825860-1|AAV70423.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825859-1|AAV70422.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825858-1|AAV70421.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825857-1|AAV70420.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825856-1|AAV70419.1| 166|Anopheles gambiae voltage gated sodium channel protein. Length = 166 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825855-1|AAV70418.1| 166|Anopheles gambiae voltage gated sodium channel protein. Length = 166 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825854-1|AAV70417.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825853-1|AAV70416.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825852-1|AAV70415.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825851-1|AAV70414.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825850-1|AAV70413.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825849-1|AAV70412.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825848-1|AAV70411.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 135 IEETAELGEVQQRP 148 >AY825847-1|AAV70410.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 135 IEETAELGEVQQRP 148 >AY825846-1|AAV70409.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825845-1|AAV70408.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825844-1|AAV70407.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825843-1|AAV70406.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825842-1|AAV70405.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825841-1|AAV70404.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825840-1|AAV70403.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825839-1|AAV70402.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825838-1|AAV70401.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825837-1|AAV70400.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 137 IEETAELGEVQQRP 150 >AY825836-1|AAV70399.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825835-1|AAV70398.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825834-1|AAV70397.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >AY825833-1|AAV70396.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 1 MEETSFIGQVQSNP 14 +EET+ +G+VQ P Sbjct: 136 IEETAELGEVQQRP 149 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 19.8 bits (39), Expect = 9.9 Identities = 5/13 (38%), Positives = 11/13 (84%) Query: 19 KGSQIVLHMQEIY 31 KGS ++L+ +++Y Sbjct: 318 KGSSVILYSEKVY 330 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.312 0.127 0.340 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,944 Number of Sequences: 2123 Number of extensions: 905 Number of successful extensions: 47 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of query: 49 length of database: 516,269 effective HSP length: 29 effective length of query: 20 effective length of database: 454,702 effective search space: 9094040 effective search space used: 9094040 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.5 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -