BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001604-TA|BGIBMGA001604-PA|undefined (105 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39815| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.1 >SB_39815| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 25.4 bits (53), Expect = 9.1 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Query: 22 CEDCVAYNN---ATGEDKN-RLRPKYENHLKE 49 CEDC+ Y+N ++ E K + P Y+ HL E Sbjct: 387 CEDCLHYDNMDKSSPEYKQWKSSPAYKRHLSE 418 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.322 0.138 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,319,101 Number of Sequences: 59808 Number of extensions: 101510 Number of successful extensions: 230 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 230 Number of HSP's gapped (non-prelim): 1 length of query: 105 length of database: 16,821,457 effective HSP length: 72 effective length of query: 33 effective length of database: 12,515,281 effective search space: 413004273 effective search space used: 413004273 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -