GeneModel BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001604-TA|BGIBMGA001604-PA|undefined
         (105 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_39815| Best HMM Match : No HMM Matches (HMM E-Value=.)              25   9.1  

>SB_39815| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 693

 Score = 25.4 bits (53), Expect = 9.1
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 4/32 (12%)

Query: 22  CEDCVAYNN---ATGEDKN-RLRPKYENHLKE 49
           CEDC+ Y+N   ++ E K  +  P Y+ HL E
Sbjct: 387 CEDCLHYDNMDKSSPEYKQWKSSPAYKRHLSE 418


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.322    0.138    0.424 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,319,101
Number of Sequences: 59808
Number of extensions: 101510
Number of successful extensions: 230
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 230
Number of HSP's gapped (non-prelim): 1
length of query: 105
length of database: 16,821,457
effective HSP length: 72
effective length of query: 33
effective length of database: 12,515,281
effective search space: 413004273
effective search space used: 413004273
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 53 (25.4 bits)