BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001603-TA|BGIBMGA001603-PA|IPR002156|Ribonuclease H, IPR012337|Polynucleotidyl transferase, Ribonuclease H fold (348 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 5.7 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 7.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 7.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 7.6 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 22 7.6 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 22 7.6 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 22 7.6 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Query: 292 KATEFKGKWYTGIQKTPPTKPWYAKTT 318 K T G +Y +Q PP P+Y T+ Sbjct: 191 KRTIALGAFYQPLQPFPPPYPFYPGTS 217 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 7.6 Identities = 23/118 (19%), Positives = 52/118 (44%), Gaps = 10/118 (8%) Query: 15 YIQVPNNNIWT----VGLPSNITRSVEDLPFVVNLQLRIKNFGYHNPRILADKSTS---L 67 Y+ + N ++T +P N+T S+++ +++ +R+K Y + + L Sbjct: 310 YLAIVFNGLFTEEDVADVPINVTLSLDEKKYILQEVVRVKKPHYELNMVEVRSPVTPADL 369 Query: 68 TVVPQQASIAASTGPSQP-THRASCSYGTQLHCLITPLQFIAAHDRIINAWGHTSPAW 124 ++ + + + S+P R S S T++ C + ++ D N +G + AW Sbjct: 370 RLLTRGRLVLTVSSVSKPEALRLSGSVVTKVTCELFQATLSSSSD--TNRFGTSGLAW 425 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 7.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Query: 55 HNPRILADKSTSLTVVPQQASIA 77 +NP I A + SL V Q+ SIA Sbjct: 1407 NNPSISAFRKKSLAYVQQRMSIA 1429 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 7.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Query: 55 HNPRILADKSTSLTVVPQQASIA 77 +NP I A + SL V Q+ SIA Sbjct: 1407 NNPSISAFRKKSLAYVQQRMSIA 1429 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.8 bits (44), Expect = 7.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 146 PQTSSSTGDNHAAFSSINNN 165 P SS+ G+N+ S+ NNN Sbjct: 119 PDISSTRGNNNNTPSATNNN 138 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 21.8 bits (44), Expect = 7.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 146 PQTSSSTGDNHAAFSSINNN 165 P SS+ G+N+ S+ NNN Sbjct: 67 PDISSTRGNNNNTPSATNNN 86 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 21.8 bits (44), Expect = 7.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 146 PQTSSSTGDNHAAFSSINNN 165 P SS+ G+N+ S+ NNN Sbjct: 250 PDISSTRGNNNNTPSATNNN 269 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.132 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,122 Number of Sequences: 317 Number of extensions: 3640 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 7 length of query: 348 length of database: 114,650 effective HSP length: 57 effective length of query: 291 effective length of database: 96,581 effective search space: 28105071 effective search space used: 28105071 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -