BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001603-TA|BGIBMGA001603-PA|IPR002156|Ribonuclease H, IPR012337|Polynucleotidyl transferase, Ribonuclease H fold (348 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10000.1 68414.m01128 expressed protein 31 1.1 >At1g10000.1 68414.m01128 expressed protein Length = 303 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 6/105 (5%) Query: 167 SIFTAEWYAIYQALLHFEXXXXXXXXXXTDSMSTINALENKSSKFNLSYIVYDIKELIYR 226 S AE +AI A+LH +DS S ++AL + S + ++ +I+ + R Sbjct: 203 SPLAAEAWAIKSAMLHALQLERSDLLVLSDSKSIVDALNSNVSLNEIFGLLVEIRSIRNR 262 Query: 227 FYCKERLVTFKWVP--LHSGITGNEEADRAATGNPDIDHSALLKV 269 F R ++F+++P ++S + +GN +D L+ V Sbjct: 263 F----RSISFQFIPRLVNSIADAAAKLSLCISGNIGLDPGTLVFV 303 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.320 0.132 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,400,507 Number of Sequences: 28952 Number of extensions: 335383 Number of successful extensions: 756 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 756 Number of HSP's gapped (non-prelim): 1 length of query: 348 length of database: 12,070,560 effective HSP length: 82 effective length of query: 266 effective length of database: 9,696,496 effective search space: 2579267936 effective search space used: 2579267936 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -