BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001601-TA|BGIBMGA001601-PA|IPR007114|Major facilitator superfamily, IPR011701|Major facilitator superfamily MFS_1 (315 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 28 0.092 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 24 2.0 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 28.3 bits (60), Expect = 0.092 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Query: 172 RVIAVAFLMTGLILINYGFVPSGNWSILLY--LGGKFFITLAYNSLYVFAA 220 R++ V L G +LI+ G VP N +++L + +IT+ Y+ L + A Sbjct: 56 RIVLVILLRAGYVLIHIGSVPVNNINLILLQNIIDICWITMVYSLLGIIIA 106 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.8 bits (49), Expect = 2.0 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 5 GGVAVTLLSWWLQNWR-YLLFIIYTPAVLVFVYIW 38 G +V +S+ LQ Y L +Y P VL+ V W Sbjct: 229 GEFSVLQVSFNLQRHTGYFLIQVYVPCVLIVVLSW 263 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.325 0.138 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,743 Number of Sequences: 429 Number of extensions: 3732 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 2 length of query: 315 length of database: 140,377 effective HSP length: 58 effective length of query: 257 effective length of database: 115,495 effective search space: 29682215 effective search space used: 29682215 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -