BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001598-TA|BGIBMGA001598-PA|IPR007110|Immunoglobulin- like, IPR013151|Immunoglobulin, IPR003599|Immunoglobulin subtype, IPR003598|Immunoglobulin subtype 2 (221 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0802 + 6246267-6247541,6247625-6247682,6247806-6248129,624... 34 0.080 06_02_0047 - 10938480-10938599,10939244-10939405,10939481-109396... 30 1.7 10_06_0177 + 11500330-11500755,11500937-11501383,11501651-11501764 28 6.9 03_05_0165 + 21435948-21436144,21436234-21436318,21436690-214367... 28 6.9 09_02_0389 - 8456957-8459917,8461941-8462267 27 9.1 >01_01_0802 + 6246267-6247541,6247625-6247682,6247806-6248129, 6248321-6248355 Length = 563 Score = 34.3 bits (75), Expect = 0.080 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Query: 7 DDASGDVSVQELENATLT-CKATGHPPPKITWRREDHEPILLKKPMSRDFDKVENYVGSS 65 D+ + D+ +++ E+A L + PP + T + E I ++ P D E YVGSS Sbjct: 395 DEMNHDIELEKTEHARLDEVEQDQMPPVQETLHNPEPESIDIEPPKENTADDNERYVGSS 454 Query: 66 LPLWRVDRR 74 P+ D++ Sbjct: 455 SPVHLEDQK 463 >06_02_0047 - 10938480-10938599,10939244-10939405,10939481-10939629, 10939753-10939912 Length = 196 Score = 29.9 bits (64), Expect = 1.7 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 6/69 (8%) Query: 30 HPPPKITWRREDHEPIL-LK---KPMSRDFDKVENYVGSSLPLWRVDRRQMGAFLCIASN 85 H K TW +E + I+ LK KP+ ++F++V+N +GS+ PL V R + I+ N Sbjct: 126 HILAKYTWAKEAQKKIVKLKEEGKPLPKNFNEVKNLMGST-PL-DVGRSNLEKSGQISRN 183 Query: 86 DVPPAVSKR 94 + P SK+ Sbjct: 184 AMCPCGSKK 192 >10_06_0177 + 11500330-11500755,11500937-11501383,11501651-11501764 Length = 328 Score = 27.9 bits (59), Expect = 6.9 Identities = 18/80 (22%), Positives = 39/80 (48%), Gaps = 2/80 (2%) Query: 15 VQELENATLTCKATGHPPPKITWRREDHEPILLKKPMSRDFDKVENYVGSSLPLWRVDRR 74 V + ++A+ + K PP K + K +R+ ++E+ + + + R RR Sbjct: 65 VDQDQHASSSSKVAARPPVKAAAAAGKRKRRRAKAAKNRE--EIESQRMTHIAVERNRRR 122 Query: 75 QMGAFLCIASNDVPPAVSKR 94 QM +L + + +PP+ ++R Sbjct: 123 QMNEYLAVLRSLMPPSYAQR 142 >03_05_0165 + 21435948-21436144,21436234-21436318,21436690-21436768, 21436892-21437005,21437249-21437361,21437570-21437677, 21437760-21437879 Length = 271 Score = 27.9 bits (59), Expect = 6.9 Identities = 26/91 (28%), Positives = 34/91 (37%), Gaps = 8/91 (8%) Query: 65 SLPLWRVDRRQMGAFLCIASNDVPPAVSKRITLLVNFAPTVKVPNQLLGAPL--GTDVKL 122 SLP W N +PP+ + + L N A T PN G G + + Sbjct: 68 SLPTWAEFELGKAPVYWKTMNGLPPSAGEGLILFYNPAATKMTPNAQFGIAFNGGFNQPI 127 Query: 123 KCYVEAYPNTINYWIKNRGEMLLDGPKYTIR 153 C E T ++ RG D P YTIR Sbjct: 128 MCGGEPRQMT----LQERGS--ADPPIYTIR 152 >09_02_0389 - 8456957-8459917,8461941-8462267 Length = 1095 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/30 (36%), Positives = 18/30 (60%) Query: 47 LKKPMSRDFDKVENYVGSSLPLWRVDRRQM 76 L+ P ++ K+ +Y GSSLP W + R + Sbjct: 741 LQPPQCLEYLKIASYYGSSLPDWILQLRNL 770 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.135 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,137,999 Number of Sequences: 37544 Number of extensions: 298137 Number of successful extensions: 590 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 588 Number of HSP's gapped (non-prelim): 5 length of query: 221 length of database: 14,793,348 effective HSP length: 79 effective length of query: 142 effective length of database: 11,827,372 effective search space: 1679486824 effective search space used: 1679486824 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -