GeneModel BLAST Result against uniref50

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001597-TA|BGIBMGA001597-PA|undefined
         (155 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q173A8 Cluster: Putative uncharacterized protein; n=1; ...    31   8.6  

>UniRef50_Q173A8 Cluster: Putative uncharacterized protein; n=1;
          Aedes aegypti|Rep: Putative uncharacterized protein -
          Aedes aegypti (Yellowfever mosquito)
          Length = 345

 Score = 31.5 bits (68), Expect = 8.6
 Identities = 17/46 (36%), Positives = 21/46 (45%)

Query: 17 MLNNKTIVXXXXXXXXXXXXXXALAGQRNRLTAEVDDLRHRLTTSS 62
          M+ NK I                LA Q+N   AE+DDLR +L  SS
Sbjct: 1  MMANKVITILSVVLFAFVISTTVLAVQKNDQAAEIDDLRAQLDASS 46


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.311    0.129    0.362 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,894,831
Number of Sequences: 1657284
Number of extensions: 2616633
Number of successful extensions: 4812
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4811
Number of HSP's gapped (non-prelim): 1
length of query: 155
length of database: 575,637,011
effective HSP length: 94
effective length of query: 61
effective length of database: 419,852,315
effective search space: 25610991215
effective search space used: 25610991215
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 68 (31.5 bits)