SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001595-TA|BGIBMGA001595-PA|IPR003010|Nitrilase/cyanide
hydratase and apolipoprotein N-acyltransferase
         (391 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    22   6.6  

>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
            adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 22.2 bits (45), Expect = 6.6
 Identities = 12/39 (30%), Positives = 20/39 (51%)

Query: 139  AESAEDGPTTTFLRELAIKYAMVIVSSILERDEKHSDIL 177
            AE    GP T+   E   ++++V+      R+E + DIL
Sbjct: 991  AEEVPGGPPTSIRVETNDQHSLVVYWKPPAREEWNGDIL 1029


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.320    0.136    0.416 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 94,637
Number of Sequences: 317
Number of extensions: 4068
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 1
length of query: 391
length of database: 114,650
effective HSP length: 58
effective length of query: 333
effective length of database: 96,264
effective search space: 32055912
effective search space used: 32055912
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 44 (21.8 bits)

- SilkBase 1999-2023 -