BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001595-TA|BGIBMGA001595-PA|IPR003010|Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase (391 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 23 3.4 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 23 3.4 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 5.9 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 23.4 bits (48), Expect = 3.4 Identities = 11/60 (18%), Positives = 25/60 (41%) Query: 245 FGQNGAEIVFNPSATIAGEGGSEYMWNVEARNAAITNCYFTAAINRVGYEEFPNEFTSAD 304 +G G +I+ + + G ++ ++ + + Y AIN YE+ +F + Sbjct: 187 YGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDDYLDYAINPFDYEKRSTDFQDVE 246 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 23.4 bits (48), Expect = 3.4 Identities = 11/60 (18%), Positives = 25/60 (41%) Query: 245 FGQNGAEIVFNPSATIAGEGGSEYMWNVEARNAAITNCYFTAAINRVGYEEFPNEFTSAD 304 +G G +I+ + + G ++ ++ + + Y AIN YE+ +F + Sbjct: 187 YGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDDYLDYAINPFDYEKRSTDFQDVE 246 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.6 bits (46), Expect = 5.9 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 6/45 (13%) Query: 1 MENETHSLESIINNNLTGRDLEEFNRIHFGRRNNLE-IKLKESSI 44 ++N+ S+E+ N + T D+E++ NLE +KLKE I Sbjct: 177 LDNQEVSMENTENKSCTDSDIEKYKMF-----CNLENVKLKELRI 216 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.136 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,752 Number of Sequences: 429 Number of extensions: 5242 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 3 length of query: 391 length of database: 140,377 effective HSP length: 59 effective length of query: 332 effective length of database: 115,066 effective search space: 38201912 effective search space used: 38201912 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -