BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001593-TA|BGIBMGA001593-PA|IPR009346|GRIM-19 (153 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 3.3 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 22 9.9 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.4 bits (48), Expect = 3.3 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 4/74 (5%) Query: 44 GMTIGSIYLYNITYKR----ILKDEIEMRSAKMAIYPALLAERDREYLKQLRRNRDAEAE 99 G IG LY KR I +DE+E S + I + RD+E + + +++ Sbjct: 556 GKEIGQTTLYFGCRKRSEDYIYEDELEDYSKRGIINLRVAFSRDQEKKVYVTHLLEQDSD 615 Query: 100 LMRDVPGWEVGTYY 113 L+ V G G +Y Sbjct: 616 LIWSVIGENKGHFY 629 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 21.8 bits (44), Expect = 9.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 22 IPFKRIPAKSYFSGYTMFAGFIGMTIGSIYLYN 54 +PF++IPA S F F G++Y N Sbjct: 42 LPFEKIPAPSLIGFLKEFGPFGKYKDGNLYDIN 74 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.321 0.139 0.418 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,498 Number of Sequences: 2123 Number of extensions: 6510 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 153 length of database: 516,269 effective HSP length: 59 effective length of query: 94 effective length of database: 391,012 effective search space: 36755128 effective search space used: 36755128 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -