BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001590-TA|BGIBMGA001590-PA|IPR002653|Zinc finger, A20-type (509 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 30 0.17 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 30 0.17 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 30 0.17 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 30 0.17 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 30 0.17 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 30 0.17 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 30 0.17 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 30 0.17 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 30 0.17 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 30 0.17 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 30 0.17 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 30 0.17 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 30 0.17 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 30 0.17 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 30 0.17 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 30 0.17 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 30 0.17 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 30 0.17 AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. 30 0.17 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 30 0.17 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 30 0.17 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 30 0.17 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 30 0.17 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 30 0.17 L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. 28 0.51 AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposa... 27 0.90 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 25 3.6 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 310 FADRLIALKRKEHALLSGQGSET 332 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 325 FADRLIALKRKEHALLSGQGSET 347 >AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 250 FADRLIALKRKEHALLSGQGSET 272 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 250 FADRLIALKRKEHALLSGQGSET 272 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 250 FADRLIALKRKEHALLSGQGSET 272 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 250 FADRLIALKRKEHALLSGQGSET 272 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 250 FADRLIALKRKEHALLSGQGSET 272 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 29.9 bits (64), Expect = 0.17 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 136 FHDRLLALRTKVQALLSGEYGET 158 F DRL+AL+ K ALLSG+ ET Sbjct: 250 FADRLIALKRKEHALLSGQGSET 272 >L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. Length = 154 Score = 28.3 bits (60), Expect = 0.51 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 6/55 (10%) Query: 387 CCRVLAARAPVQEEMVKNY--LNEAWTG-YTAEKNRKEASPCEPGQPRYGTGKSQ 438 C ++L P E ++ Y + E W YT E NR+ A G+P GK+Q Sbjct: 15 CLQLLTRNIP---EFLRRYVTMGETWLHHYTPESNRQSAQWTATGEPAPKRGKTQ 66 >AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposase protein. Length = 336 Score = 27.5 bits (58), Expect = 0.90 Identities = 24/105 (22%), Positives = 46/105 (43%), Gaps = 9/105 (8%) Query: 275 DVEHDQKVINNLLPDEYERSAMLAAYLDLERVECVTQNQPPEELRRSLDALSTKSSKQLN 334 + E +K+++N L + ++ LA L R N ++R + L+T Q N Sbjct: 2 EAERREKIVHNYLENPLWSASRLAKKLKFPR------NTVWRVIKRYKEILTTIRKPQAN 55 Query: 335 SVAKQFGSIGRSMSSKIKKNFGSMAKLTGKSSGSQSNPEESLVRR 379 ++ G++ +++ SKI K L+ + + S VRR Sbjct: 56 ---RRSGTVDQNLRSKILKTIKGNPNLSDRDLARKFGATHSTVRR 97 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 25.4 bits (53), Expect = 3.6 Identities = 11/36 (30%), Positives = 19/36 (52%) Query: 442 EADRAAHELARSHAARSGRPAADRTLYLSRSTFYVD 477 E D A+H A SH + G ++++ + +FY D Sbjct: 580 EEDNASHSSASSHGSSDGPSSSEKLKRQAIDSFYHD 615 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.317 0.133 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 565,681 Number of Sequences: 2123 Number of extensions: 23488 Number of successful extensions: 93 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 50 Number of HSP's gapped (non-prelim): 44 length of query: 509 length of database: 516,269 effective HSP length: 67 effective length of query: 442 effective length of database: 374,028 effective search space: 165320376 effective search space used: 165320376 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -