BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001589-TA|BGIBMGA001589-PA|IPR000008|C2 calcium-dependent membrane targeting, IPR001565|Synaptotagmin, IPR008973|C2 calcium/lipid-binding region, CaLB (312 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g04220.2 68418.m00411 C2 domain-containing protein (sytC) GC ... 70 2e-12 At5g04220.1 68418.m00410 C2 domain-containing protein (sytC) GC ... 70 2e-12 At1g20080.1 68414.m02513 C2 domain-containing protein contains I... 61 8e-10 At2g20990.1 68415.m02485 C2 domain-containing protein (sytA) sim... 54 1e-07 At1g03370.1 68414.m00316 C2 domain-containing protein / GRAM dom... 53 2e-07 At3g61300.1 68416.m06860 C2 domain-containing protein anthranila... 52 4e-07 At1g05500.1 68414.m00561 C2 domain-containing protein similar to... 50 3e-06 At1g22610.1 68414.m02823 C2 domain-containing protein contains I... 49 4e-06 At4g11610.1 68417.m01859 C2 domain-containing protein contains I... 47 2e-05 At2g21010.1 68415.m02489 C2 domain-containing protein contains I... 44 1e-04 At5g11100.1 68418.m01296 C2 domain-containing protein similar to... 44 2e-04 At4g21160.4 68417.m03061 zinc finger and C2 domain protein (ZAC)... 44 2e-04 At4g21160.3 68417.m03060 zinc finger and C2 domain protein (ZAC)... 44 2e-04 At4g21160.2 68417.m03059 zinc finger and C2 domain protein (ZAC)... 44 2e-04 At4g21160.1 68417.m03058 zinc finger and C2 domain protein (ZAC)... 44 2e-04 At5g17980.1 68418.m02109 C2 domain-containing protein contains I... 43 3e-04 At5g48060.1 68418.m05938 C2 domain-containing protein contains I... 42 5e-04 At3g18370.1 68416.m02336 C2 domain-containing protein contains P... 42 5e-04 At1g73580.1 68414.m08518 C2 domain-containing protein similar to... 42 7e-04 At1g66360.1 68414.m07537 C2 domain-containing protein similar to... 40 0.002 At1g51570.1 68414.m05804 C2 domain-containing protein contains I... 40 0.002 At1g48590.1 68414.m05433 C2 domain-containing protein similar to... 40 0.002 At5g12970.1 68418.m01487 C2 domain-containing protein contains I... 40 0.003 At3g57880.1 68416.m06452 C2 domain-containing protein contains I... 40 0.003 At1g53590.1 68414.m06088 C2 domain-containing protein 40 0.003 At3g07940.1 68416.m00971 zinc finger and C2 domain protein, puta... 39 0.004 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 39 0.005 At1g04150.1 68414.m00405 C2 domain-containing protein contains I... 39 0.005 At4g00700.1 68417.m00096 C2 domain-containing protein contains I... 38 0.007 At4g05330.1 68417.m00815 zinc finger and C2 domain protein, puta... 38 0.009 At5g61900.3 68418.m07767 copine BONZAI1 (BON1) nearly identical ... 38 0.011 At5g61900.1 68418.m07766 copine BONZAI1 (BON1) nearly identical ... 38 0.011 At3g17980.1 68416.m02287 C2 domain-containing protein similar to... 38 0.011 At5g50170.1 68418.m06213 C2 domain-containing protein / GRAM dom... 37 0.015 At2g40116.1 68415.m04933 phosphoinositide-specific phospholipase... 37 0.015 At2g01540.1 68415.m00078 C2 domain-containing protein similar to... 37 0.020 At3g59660.1 68416.m06656 C2 domain-containing protein / GRAM dom... 36 0.026 At3g55470.1 68416.m06160 C2 domain-containing protein similar to... 36 0.026 At5g37740.1 68418.m04543 C2 domain-containing protein similar to... 36 0.035 At4g13550.1 68417.m02112 lipase class 3 family protein very low ... 36 0.035 At3g14590.1 68416.m01847 C2 domain-containing protein low simila... 36 0.035 At5g06850.1 68418.m00774 C2 domain-containing protein contains I... 34 0.11 At3g47290.1 68416.m05139 phosphoinositide-specific phospholipase... 33 0.33 At1g70790.2 68414.m08163 C2 domain-containing protein similar to... 33 0.33 At1g70790.1 68414.m08162 C2 domain-containing protein similar to... 33 0.33 At1g44120.1 68414.m05096 C2 domain-containing protein / armadill... 31 1.3 At1g63220.1 68414.m07146 C2 domain-containing protein similar to... 30 1.7 At3g19830.1 68416.m02512 C2 domain-containing protein low simila... 30 2.3 At1g08230.1 68414.m00909 amino acid transporter family protein l... 30 2.3 At5g18480.1 68418.m02179 glycogenin glucosyltransferase (glycoge... 29 3.0 At5g47710.1 68418.m05891 C2 domain-containing protein contains s... 29 4.0 At2g21040.1 68415.m02495 C2 domain-containing protein low simila... 29 4.0 At1g08860.1 68414.m00987 copine, putative Similar to BONZAI1 [Ar... 29 4.0 At5g40480.1 68418.m04909 expressed protein ; expression supporte... 29 5.3 At1g55320.1 68414.m06319 acyl-activating enzyme 18 (AAE18) nearl... 28 7.0 At5g58700.1 68418.m07354 phosphoinositide-specific phospholipase... 28 9.2 At5g42870.1 68418.m05225 lipin family protein contains Pfam prof... 28 9.2 >At5g04220.2 68418.m00411 C2 domain-containing protein (sytC) GC donor splice site at exon 3; similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 540 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/89 (43%), Positives = 57/89 (64%), Gaps = 7/89 (7%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V +L+ARNL + DL G +DPYVK+ L G+++ KKT +KKR LNP +NE F + Sbjct: 263 LHVSILRARNLLKKDLLGTSDPYVKLSL--TGEKLPAKKTTIKKRNLNPEWNEHFKL-IV 319 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIG 277 PN+ + L+L V DWD+V ++ +G Sbjct: 320 KDPNSQV----LQLEVFDWDKVGGHDRLG 344 Score = 37.1 bits (82), Expect = 0.015 Identities = 45/188 (23%), Positives = 79/188 (42%), Gaps = 14/188 (7%) Query: 55 LVVSVVSCQNLPGREPAGP-DPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAP 113 L VS++ +NL ++ G DPYVKL L +K KT + ++ P ++E F P Sbjct: 263 LHVSILRARNLLKKDLLGTSDPYVKLSLTGEKLPAKKTTIKKRNLNPEWNEHFKLIVKDP 322 Query: 114 HQIAGITLHFVVLSFDRYSRDEIIGEVVSPLSNLQLHSGEAMALCREIQPRSLKMRSAG- 172 + L V +D+ + +G + PL +++ GE ++ S + +G Sbjct: 323 N---SQVLQLEVFDWDKVGGHDRLGMQMIPLQ--KINPGERKEFNLDLIKNSNVVMDSGD 377 Query: 173 ---RGEVLVSLCWQPAAARLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTH 229 RG + V L + P +K R R + + D ++ L + + K Sbjct: 378 KKKRGRLEVDLRYVPFREE----SIKRRKESREEKSSEDDDFLSQAGLLSVAVQSAKDVE 433 Query: 230 VKKRTLNP 237 KK+ NP Sbjct: 434 GKKKHSNP 441 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/59 (28%), Positives = 36/59 (61%), Gaps = 4/59 (6%) Query: 50 NEKNALVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTF 108 ++ L V+V S +++ G++ +PY + +K+ KT++++KTR P ++E+F F Sbjct: 417 SQAGLLSVAVQSAKDVEGKKKHS-NPYAVVLFRGEKK---KTKMLKKTRDPRWNEEFQF 471 >At5g04220.1 68418.m00410 C2 domain-containing protein (sytC) GC donor splice site at exon 3; similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 318 Score = 69.7 bits (163), Expect = 2e-12 Identities = 39/89 (43%), Positives = 57/89 (64%), Gaps = 7/89 (7%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V +L+ARNL + DL G +DPYVK+ L G+++ KKT +KKR LNP +NE F + Sbjct: 41 LHVSILRARNLLKKDLLGTSDPYVKLSL--TGEKLPAKKTTIKKRNLNPEWNEHFKL-IV 97 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIG 277 PN+ + L+L V DWD+V ++ +G Sbjct: 98 KDPNSQV----LQLEVFDWDKVGGHDRLG 122 Score = 37.1 bits (82), Expect = 0.015 Identities = 45/188 (23%), Positives = 79/188 (42%), Gaps = 14/188 (7%) Query: 55 LVVSVVSCQNLPGREPAGP-DPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAP 113 L VS++ +NL ++ G DPYVKL L +K KT + ++ P ++E F P Sbjct: 41 LHVSILRARNLLKKDLLGTSDPYVKLSLTGEKLPAKKTTIKKRNLNPEWNEHFKLIVKDP 100 Query: 114 HQIAGITLHFVVLSFDRYSRDEIIGEVVSPLSNLQLHSGEAMALCREIQPRSLKMRSAG- 172 + L V +D+ + +G + PL +++ GE ++ S + +G Sbjct: 101 N---SQVLQLEVFDWDKVGGHDRLGMQMIPLQ--KINPGERKEFNLDLIKNSNVVMDSGD 155 Query: 173 ---RGEVLVSLCWQPAAARLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTH 229 RG + V L + P +K R R + + D ++ L + + K Sbjct: 156 KKKRGRLEVDLRYVPFREE----SIKRRKESREEKSSEDDDFLSQAGLLSVAVQSAKDVE 211 Query: 230 VKKRTLNP 237 KK+ NP Sbjct: 212 GKKKHSNP 219 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/59 (28%), Positives = 36/59 (61%), Gaps = 4/59 (6%) Query: 50 NEKNALVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTF 108 ++ L V+V S +++ G++ +PY + +K+ KT++++KTR P ++E+F F Sbjct: 195 SQAGLLSVAVQSAKDVEGKKKHS-NPYAVVLFRGEKK---KTKMLKKTRDPRWNEEFQF 249 >At1g20080.1 68414.m02513 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 535 Score = 61.3 bits (142), Expect = 8e-10 Identities = 36/89 (40%), Positives = 53/89 (59%), Gaps = 7/89 (7%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L+V ++KA L + DL G +DPYVK+ L +G ++ KKT VK LNP +NE F V Sbjct: 260 LSVKVIKAIKLKKKDLLGGSDPYVKLTL--SGDKVPGKKTVVKHSNLNPEWNEEFDLVVK 317 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIG 277 + L+L+V DW++V K++ IG Sbjct: 318 EP-----ESQELQLIVYDWEQVGKHDKIG 341 Score = 39.9 bits (89), Expect = 0.002 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 7/133 (5%) Query: 55 LVVSVVSCQNLPGREP-AGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAP 113 L V V+ L ++ G DPYVKL L DK KT V P ++E+F P Sbjct: 260 LSVKVIKAIKLKKKDLLGGSDPYVKLTLSGDKVPGKKTVVKHSNLNPEWNEEFDLVVKEP 319 Query: 114 HQIAGITLHFVVLSFDRYSRDEIIGEVVSPLSNLQLHSGEAMA--LCREIQPRSLKMRSA 171 L +V +++ + + IG V L +L + M L + ++P+ + Sbjct: 320 E---SQELQLIVYDWEQVGKHDKIGMNVIQLKDLTPEEPKLMTLELLKSMEPKE-PVSEK 375 Query: 172 GRGEVLVSLCWQP 184 RG+++V + ++P Sbjct: 376 SRGQLVVEVEYKP 388 Score = 29.5 bits (63), Expect = 3.0 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 5/54 (9%) Query: 55 LVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTF 108 LVV V ++L G+ P V+L +++ KT+ V+K R P +DEDF F Sbjct: 418 LVVIVHEAEDLEGKYHTNPS--VRLLFRGEER---KTKRVKKNREPRWDEDFQF 466 >At2g20990.1 68415.m02485 C2 domain-containing protein (sytA) similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 541 Score = 54.0 bits (124), Expect = 1e-07 Identities = 35/87 (40%), Positives = 49/87 (56%), Gaps = 7/87 (8%) Query: 191 VVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVPAA 250 V +++A L + DL G ADP+VK+ L + +I KKT VK + LNP +NE F F V Sbjct: 264 VKVVRAVGLRKKDLMGGADPFVKIKL--SEDKIPSKKTTVKHKNLNPEWNEEFKFSV-RD 320 Query: 251 PNAALDHVSLELLVLDWDRVTKNEVIG 277 P + LE V DW++V E +G Sbjct: 321 PQTQV----LEFSVYDWEQVGNPEKMG 343 Score = 35.5 bits (78), Expect = 0.046 Identities = 26/86 (30%), Positives = 38/86 (44%), Gaps = 3/86 (3%) Query: 72 GPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPHQIAGITLHFVVLSFDRY 131 G DP+VK++L DK KT V K P ++E+F F P L F V +++ Sbjct: 280 GADPFVKIKLSEDKIPSKKTTVKHKNLNPEWNEEFKFSVRDPQT---QVLEFSVYDWEQV 336 Query: 132 SRDEIIGEVVSPLSNLQLHSGEAMAL 157 E +G V L + +A L Sbjct: 337 GNPEKMGMNVLALKEMVPDEHKAFTL 362 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 5/54 (9%) Query: 55 LVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTF 108 LVV V S +++ G+ +PYV++ K + KT+ V+K R P ++E+FTF Sbjct: 422 LVVIVHSAEDVEGKHHT--NPYVRIYF---KGEERKTKHVKKNRDPRWNEEFTF 470 Score = 31.1 bits (67), Expect = 0.99 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 11/79 (13%) Query: 184 PAAARLTVVLLKARNLPRMDLTGL--ADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNE 241 PAA + VV++ + D+ G +PYV++Y + G+ +K HVKK +P +NE Sbjct: 416 PAAGGMLVVIVHSAE----DVEGKHHTNPYVRIY--FKGEE--RKTKHVKKNR-DPRWNE 466 Query: 242 SFVFEVPAAPNAALDHVSL 260 F F + P HV + Sbjct: 467 EFTFMLEEPPVREKLHVEV 485 >At1g03370.1 68414.m00316 C2 domain-containing protein / GRAM domain-containing protein contains Pfam profiles PF00168: C2 domain; contains PF02893: GRAM domain; similar to Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length(GI:6980525); similar to Synaptotagmin III (SytIII) (Swiss-Prot:P40748) [Rattus norvegicus] Length = 1859 Score = 53.2 bits (122), Expect = 2e-07 Identities = 33/94 (35%), Positives = 55/94 (58%), Gaps = 11/94 (11%) Query: 188 RLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEV 247 +L V +++ARNLP MDL G +DPYV++ L G++ + +T V K+ LNP + E F F V Sbjct: 828 KLQVRVVEARNLPAMDLNGFSDPYVRLQL---GKQ--RSRTKVVKKNLNPKWTEDFSFGV 882 Query: 248 PAAPNAALDHVSLELLVLDWDRVTKNEVIGRLEL 281 + L + VLD D+ ++ +G++ + Sbjct: 883 DDLND------ELVVSVLDEDKYFNDDFVGQVRV 910 Score = 51.6 bits (118), Expect = 7e-07 Identities = 44/131 (33%), Positives = 68/131 (51%), Gaps = 12/131 (9%) Query: 55 LVVSVVSCQNLPGREPAG-PDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAP 113 L V VV +NLP + G DPYV+LQL KQ +T+VV+K P + EDF+F G+ Sbjct: 829 LQVRVVEARNLPAMDLNGFSDPYVRLQL--GKQRS-RTKVVKKNLNPKWTEDFSF-GV-- 882 Query: 114 HQIAGITLHFVVLSFDRYSRDEIIGEVVSPLSNLQLHSGEAMALCREIQPRSLKMRSAGR 173 L VL D+Y D+ +G+V +S + E +L P + K + + + Sbjct: 883 -DDLNDELVVSVLDEDKYFNDDFVGQVRVSVS--LVFDAENQSLGTVWYPLNPKKKGSKK 939 Query: 174 --GEVLVSLCW 182 GE+L+ +C+ Sbjct: 940 DCGEILLKICF 950 Score = 35.9 bits (79), Expect = 0.035 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 5/68 (7%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 LTV L++ +L +D +G DPY+ NG+ + + +K + NP +NE F F+ Sbjct: 1363 LTVALIEGVDLAAVDPSGHCDPYI--VFTSNGK---TRTSSIKFQKSNPQWNEIFEFDAM 1417 Query: 249 AAPNAALD 256 A P + L+ Sbjct: 1418 ADPPSVLN 1425 >At3g61300.1 68416.m06860 C2 domain-containing protein anthranilate phosphoribosyltransferase (fragment) - Pisum sativum, PIR:T06460 Length = 972 Score = 52.4 bits (120), Expect = 4e-07 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 11/89 (12%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L + ++KARNLP MDLTG DPY+++ L G K K H +K NPV+NE F F Sbjct: 251 LFIKIVKARNLPSMDLTGSLDPYIEVKL---GNYTGKTK-HFEKNQ-NPVWNEVFAFSKS 305 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIG 277 + LE++V+D D V K++ +G Sbjct: 306 NQQSNV-----LEVIVMDKDMV-KDDFVG 328 >At1g05500.1 68414.m00561 C2 domain-containing protein similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 528 Score = 49.6 bits (113), Expect = 3e-06 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEV 247 L+V ++ A +P DL G ADPYV + + +G AK KT V +LNPV+N++F F V Sbjct: 405 LSVTVISAEEIPIQDLMGKADPYVVLSMKKSG---AKSKTRVVNDSLNPVWNQTFDFVV 460 Score = 48.0 bits (109), Expect = 8e-06 Identities = 31/89 (34%), Positives = 50/89 (56%), Gaps = 7/89 (7%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V L++A+NL DL G +DP+ KM++ ++ + KT LNP++NE F F V Sbjct: 232 LEVKLVQAKNLTNKDLVGKSDPFAKMFIRPLREKTKRSKT--INNDLNPIWNEHFEFVV- 288 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIG 277 +A+ H L + + D + V +E+IG Sbjct: 289 --EDASTQH--LVVRIYDDEGVQASELIG 313 Score = 35.5 bits (78), Expect = 0.046 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Query: 52 KNALVVSVVSCQNLPGREPAGP-DPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTF 108 + L V+V+S + +P ++ G DPYV L + K KTRVV + PV+++ F F Sbjct: 402 RGVLSVTVISAEEIPIQDLMGKADPYVVLSMKKSGA-KSKTRVVNDSLNPVWNQTFDF 458 Score = 33.1 bits (72), Expect = 0.25 Identities = 30/134 (22%), Positives = 61/134 (45%), Gaps = 11/134 (8%) Query: 55 LVVSVVSCQNLPGREPAGP-DPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAP 113 L V +V +NL ++ G DP+ K+ + P ++ +++ + P+++E F F Sbjct: 232 LEVKLVQAKNLTNKDLVGKSDPFAKMFIRPLREKTKRSKTINNDLNPIWNEHFEFV---- 287 Query: 114 HQIAGITLHFVVLSFD--RYSRDEIIGEVVSPLSNLQLHSGEAMAL-CREIQPRSLKMRS 170 T H VV +D E+IG + + +L G+ + + ++ ++ + Sbjct: 288 -VEDASTQHLVVRIYDDEGVQASELIG--CAQIRLCELEPGKVKDVWLKLVKDLEIQRDT 344 Query: 171 AGRGEVLVSLCWQP 184 RGEV + L + P Sbjct: 345 KNRGEVHLELLYIP 358 >At1g22610.1 68414.m02823 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1029 Score = 49.2 bits (112), Expect = 4e-06 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 10/93 (10%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V ++KAR+LP MD++G DPYV++ L N + + K H++K + NP++ + F F Sbjct: 296 LYVSVVKARDLPVMDVSGSLDPYVEV-KLGNYKGLTK---HLEKNS-NPIWKQIFAFS-- 348 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRLEL 281 L LE+ V D D +TK++ +GR+ + Sbjct: 349 ---KERLQSNLLEVTVKDKDLLTKDDFVGRVHI 378 Score = 32.3 bits (70), Expect = 0.43 Identities = 26/95 (27%), Positives = 52/95 (54%), Gaps = 8/95 (8%) Query: 188 RLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEV 247 +L V ++ A +L D G A P+V++ ++ QR ++T + + LNP +NE VF V Sbjct: 3 KLVVEIVDASDLMPKDGQGSASPFVEVE--FDEQR---QRTQTRFKDLNPQWNEKLVFNV 57 Query: 248 PAAPNAALDHVSLELLVLDWDRVTK-NEVIGRLEL 281 L++ ++++ V D R + + +GR+++ Sbjct: 58 --GDLKRLNNKTVDVTVYDDRRDNQPGKFLGRVKI 90 >At4g11610.1 68417.m01859 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1011 Score = 46.8 bits (106), Expect = 2e-05 Identities = 32/95 (33%), Positives = 54/95 (56%), Gaps = 8/95 (8%) Query: 188 RLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEV 247 +L V ++ A NL D G ++ YV++Y ++GQ K +T +K R LNPV+NESF F + Sbjct: 7 KLGVDVIGAHNLFPKDGQGTSNAYVELY--FDGQ---KHRTTIKDRDLNPVWNESFFFNI 61 Query: 248 PAAPNAALDHVSLELLVLDWDRVTK-NEVIGRLEL 281 + + L +++LE +R T +G++ L Sbjct: 62 --SDPSRLHYLNLEAQAYSHNRSTNGRSFLGKVSL 94 Score = 38.7 bits (86), Expect = 0.005 Identities = 34/107 (31%), Positives = 53/107 (49%), Gaps = 12/107 (11%) Query: 57 VSVVSCQNL-PGREPAGPDPYVKLQLLPDKQHKVKTRVVR-KTRCPVYDEDFTFYGIAPH 114 V+V+ Q+L P + PD YVK QL +KTR + +T V++EDF F P Sbjct: 446 VNVIEAQDLIPTDKTRFPDVYVKAQL---GNQVMKTRPCQARTLGAVWNEDFLFVVAEPF 502 Query: 115 QIAGITLHFVVLSFDRYS--RDEIIGEVVSPLSNLQLHSGEAMALCR 159 + H V+ DR + +DEI+G PL+ ++ + + M R Sbjct: 503 ED-----HLVLTVEDRVAPGKDEIVGRTYIPLNTVEKRADDHMIHAR 544 Score = 36.7 bits (81), Expect = 0.020 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 11/89 (12%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V ++KAR LP MD+TG DP+V++ + N + I + H +KR +P +N+ F F Sbjct: 280 LYVRVVKARELPIMDITGSVDPFVEV-RVGNYKGITR---HFEKRQ-HPEWNQVFAF--- 331 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIG 277 + LE++V D D + K++ +G Sbjct: 332 --AKERMQASVLEVVVKDKD-LLKDDYVG 357 Score = 36.3 bits (80), Expect = 0.026 Identities = 33/88 (37%), Positives = 47/88 (53%), Gaps = 9/88 (10%) Query: 191 VVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVPAA 250 V +++A++L D T D YVK L G ++ K + + RTL V+NE F+F V A Sbjct: 446 VNVIEAQDLIPTDKTRFPDVYVKAQL---GNQVMKTRP-CQARTLGAVWNEDFLF-VVAE 500 Query: 251 PNAALDHVSLELLVLDWDRVTKNEVIGR 278 P DH L L V D K+E++GR Sbjct: 501 PFE--DH--LVLTVEDRVAPGKDEIVGR 524 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/63 (26%), Positives = 31/63 (49%) Query: 86 QHKVKTRVVRKTRCPVYDEDFTFYGIAPHQIAGITLHFVVLSFDRYSRDEIIGEVVSPLS 145 Q V+TR + CP Y+E +T+ P + + + ++ +RD IG++ LS Sbjct: 638 QKWVRTRTMVDNLCPKYNEQYTWEVFDPATVLTVGVFDNGQLGEKGNRDVKIGKIRIRLS 697 Query: 146 NLQ 148 L+ Sbjct: 698 TLE 700 >At2g21010.1 68415.m02489 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 256 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 7/72 (9%) Query: 206 GLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVPAAPNAALDHVSLELLVL 265 G+ +PYV++ L + +I+ KKT VK + LNP +NE F F V P + LE V Sbjct: 2 GMINPYVQIEL--SEDKISSKKTTVKHKNLNPEWNEEFKFSV-RDPKTQV----LEFNVY 54 Query: 266 DWDRVTKNEVIG 277 W+++ K++ +G Sbjct: 55 GWEKIGKHDKMG 66 Score = 35.9 bits (79), Expect = 0.035 Identities = 50/204 (24%), Positives = 84/204 (41%), Gaps = 25/204 (12%) Query: 74 DPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPHQIAGITLHFVVLSFDRYSR 133 +PYV+++L DK KT V K P ++E+F F P L F V +++ + Sbjct: 5 NPYVQIELSEDKISSKKTTVKHKNLNPEWNEEFKFSVRDPKT---QVLEFNVYGWEKIGK 61 Query: 134 DEIIGEVVSPLSNLQLHSGEA--MALCREIQPRSLKMRSAGRGEVLVSLCWQPAAARLTV 191 + +G V L L +A + L + + RG++ V L ++P Sbjct: 62 HDKMGMNVLALKELAPDERKAFTLELRKTLDGGEEGQPGKYRGKLEVELLYKPFTEEEMQ 121 Query: 192 VLLKA-RNLP------------RMDLTGL--ADPYVKMYLLYNGQRIAKKKTHVKKRTLN 236 + KA P D+ G +PYV +Y + G+ ++KT K+ + Sbjct: 122 AVQKAPEGTPVAGGMLVVIVHSAEDVEGKHHTNPYVHIY--FKGE---ERKTKNVKKNKD 176 Query: 237 PVFNESFVFEVPAAPNAALDHVSL 260 P +NE F F + P HV + Sbjct: 177 PKWNEEFSFMLEEPPVHEKLHVEV 200 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 5/54 (9%) Query: 55 LVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTF 108 LVV V S +++ G+ +PYV + K + KT+ V+K + P ++E+F+F Sbjct: 137 LVVIVHSAEDVEGKHHT--NPYVHIYF---KGEERKTKNVKKNKDPKWNEEFSF 185 >At5g11100.1 68418.m01296 C2 domain-containing protein similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 574 Score = 43.6 bits (98), Expect = 2e-04 Identities = 34/91 (37%), Positives = 50/91 (54%), Gaps = 9/91 (9%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L+V ++ A +LP +D G AD +V + L + K KT V +LNPV+N++F F V Sbjct: 450 LSVTVVAAEDLPAVDFMGKADAFVVITLKKSE---TKSKTRVVPDSLNPVWNQTFDFVVE 506 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRL 279 A H L L V D D+ K++ IGR+ Sbjct: 507 DAL-----HDLLTLEVWDHDKFGKDK-IGRV 531 Score = 42.3 bits (95), Expect = 4e-04 Identities = 27/94 (28%), Positives = 52/94 (55%), Gaps = 7/94 (7%) Query: 188 RLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEV 247 +L V +++A++L D+ G +DPY +++ R KKT +LNP++NE F F V Sbjct: 272 KLDVKVVQAKDLANKDMIGKSDPYAIVFIRPLPDRT--KKTKTISNSLNPIWNEHFEFIV 329 Query: 248 PAAPNAALDHVSLELLVLDWDRVTKNEVIGRLEL 281 + + H+++ V D + V +++IG ++ Sbjct: 330 ---EDVSTQHLTVR--VFDDEGVGSSQLIGAAQV 358 Score = 37.1 bits (82), Expect = 0.015 Identities = 38/134 (28%), Positives = 63/134 (47%), Gaps = 15/134 (11%) Query: 52 KNALVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTF-YG 110 + L V+VV+ ++LP + G + L + K KTRVV + PV+++ F F Sbjct: 447 RGVLSVTVVAAEDLPAVDFMGKADAFVVITLKKSETKSKTRVVPDSLNPVWNQTFDFVVE 506 Query: 111 IAPHQIAGITLHFVVLSFDRYSRDEIIGEVVSPLSNLQLHSGEAMALCREIQPRSLKMRS 170 A H + +TL V D++ +D+ IG V+ L+ + L E Q ++ Sbjct: 507 DALHDL--LTLE--VWDHDKFGKDK-IGRVIMTLTRVMLEG--------EFQ-EWFELDG 552 Query: 171 AGRGEVLVSLCWQP 184 A G++ V L W P Sbjct: 553 AKSGKLCVHLKWTP 566 Score = 32.3 bits (70), Expect = 0.43 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 12/98 (12%) Query: 55 LVVSVVSCQNLPGREPAGP-DPY--VKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGI 111 L V VV ++L ++ G DPY V ++ LPD+ K KT + + P+++E F F Sbjct: 273 LDVKVVQAKDLANKDMIGKSDPYAIVFIRPLPDRTKKTKT--ISNSLNPIWNEHFEF--- 327 Query: 112 APHQIAGITLHFVVLSFD--RYSRDEIIGEVVSPLSNL 147 ++ T H V FD ++IG PL+ L Sbjct: 328 IVEDVS--TQHLTVRVFDDEGVGSSQLIGAAQVPLNEL 363 >At4g21160.4 68417.m03061 zinc finger and C2 domain protein (ZAC) identical to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 337 Score = 43.6 bits (98), Expect = 2e-04 Identities = 34/121 (28%), Positives = 58/121 (47%), Gaps = 12/121 (9%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V + K N+ D+ +DPYV + L GQ+ K ++ V K LNPV+NE + VP Sbjct: 183 LKVTIKKGTNMAIRDMMS-SDPYVVLTL---GQQ--KAQSTVVKSNLNPVWNEELMLSVP 236 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRLELXXXXXXXXRHHWREVQAAPRRQIADWH 308 ++ S++L V D+D + ++++G E+ + + + QI W Sbjct: 237 H------NYGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQIGKWL 290 Query: 309 K 309 K Sbjct: 291 K 291 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 7/85 (8%) Query: 55 LVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPH 114 L V++ N+ R+ DPYV L L Q K ++ VV+ PV++E+ PH Sbjct: 183 LKVTIKKGTNMAIRDMMSSDPYVVLTL---GQQKAQSTVVKSNLNPVWNEELMLS--VPH 237 Query: 115 QIAGITLHFVVLSFDRYSRDEIIGE 139 + L V +D +S D+I+GE Sbjct: 238 NYGSVKLQ--VFDYDTFSADDIMGE 260 >At4g21160.3 68417.m03060 zinc finger and C2 domain protein (ZAC) identical to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 337 Score = 43.6 bits (98), Expect = 2e-04 Identities = 34/121 (28%), Positives = 58/121 (47%), Gaps = 12/121 (9%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V + K N+ D+ +DPYV + L GQ+ K ++ V K LNPV+NE + VP Sbjct: 183 LKVTIKKGTNMAIRDMMS-SDPYVVLTL---GQQ--KAQSTVVKSNLNPVWNEELMLSVP 236 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRLELXXXXXXXXRHHWREVQAAPRRQIADWH 308 ++ S++L V D+D + ++++G E+ + + + QI W Sbjct: 237 H------NYGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQIGKWL 290 Query: 309 K 309 K Sbjct: 291 K 291 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 7/85 (8%) Query: 55 LVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPH 114 L V++ N+ R+ DPYV L L Q K ++ VV+ PV++E+ PH Sbjct: 183 LKVTIKKGTNMAIRDMMSSDPYVVLTL---GQQKAQSTVVKSNLNPVWNEELMLS--VPH 237 Query: 115 QIAGITLHFVVLSFDRYSRDEIIGE 139 + L V +D +S D+I+GE Sbjct: 238 NYGSVKLQ--VFDYDTFSADDIMGE 260 >At4g21160.2 68417.m03059 zinc finger and C2 domain protein (ZAC) identical to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 337 Score = 43.6 bits (98), Expect = 2e-04 Identities = 34/121 (28%), Positives = 58/121 (47%), Gaps = 12/121 (9%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V + K N+ D+ +DPYV + L GQ+ K ++ V K LNPV+NE + VP Sbjct: 183 LKVTIKKGTNMAIRDMMS-SDPYVVLTL---GQQ--KAQSTVVKSNLNPVWNEELMLSVP 236 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRLELXXXXXXXXRHHWREVQAAPRRQIADWH 308 ++ S++L V D+D + ++++G E+ + + + QI W Sbjct: 237 H------NYGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQIGKWL 290 Query: 309 K 309 K Sbjct: 291 K 291 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 7/85 (8%) Query: 55 LVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPH 114 L V++ N+ R+ DPYV L L Q K ++ VV+ PV++E+ PH Sbjct: 183 LKVTIKKGTNMAIRDMMSSDPYVVLTL---GQQKAQSTVVKSNLNPVWNEELMLS--VPH 237 Query: 115 QIAGITLHFVVLSFDRYSRDEIIGE 139 + L V +D +S D+I+GE Sbjct: 238 NYGSVKLQ--VFDYDTFSADDIMGE 260 >At4g21160.1 68417.m03058 zinc finger and C2 domain protein (ZAC) identical to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 337 Score = 43.6 bits (98), Expect = 2e-04 Identities = 34/121 (28%), Positives = 58/121 (47%), Gaps = 12/121 (9%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V + K N+ D+ +DPYV + L GQ+ K ++ V K LNPV+NE + VP Sbjct: 183 LKVTIKKGTNMAIRDMMS-SDPYVVLTL---GQQ--KAQSTVVKSNLNPVWNEELMLSVP 236 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRLELXXXXXXXXRHHWREVQAAPRRQIADWH 308 ++ S++L V D+D + ++++G E+ + + + QI W Sbjct: 237 H------NYGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQIGKWL 290 Query: 309 K 309 K Sbjct: 291 K 291 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 7/85 (8%) Query: 55 LVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPH 114 L V++ N+ R+ DPYV L L Q K ++ VV+ PV++E+ PH Sbjct: 183 LKVTIKKGTNMAIRDMMSSDPYVVLTL---GQQKAQSTVVKSNLNPVWNEELMLS--VPH 237 Query: 115 QIAGITLHFVVLSFDRYSRDEIIGE 139 + L V +D +S D+I+GE Sbjct: 238 NYGSVKLQ--VFDYDTFSADDIMGE 260 >At5g17980.1 68418.m02109 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1049 Score = 42.7 bits (96), Expect = 3e-04 Identities = 32/97 (32%), Positives = 51/97 (52%), Gaps = 8/97 (8%) Query: 188 RLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEV 247 +L V ++ A++L D G + PYV L Y GQR ++T R LNPV+NE+ F + Sbjct: 6 KLVVEVVDAKDLTPKDGHGTSSPYV--VLDYYGQR---RRTRTIVRDLNPVWNETLEFSL 60 Query: 248 PAAPNAALDHVSLELLVL---DWDRVTKNEVIGRLEL 281 P+ L LEL + ++ + +N +GR+ L Sbjct: 61 AKRPSHQLFTDVLELDMYHDKNFGQTRRNNFLGRIRL 97 >At5g48060.1 68418.m05938 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1036 Score = 41.9 bits (94), Expect = 5e-04 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 8/95 (8%) Query: 55 LVVSVVSCQNLP-GREPAGPDPYVKLQLLPDKQHKVKTRVV-RKTRCPVYDEDFTFYGIA 112 L V VV + LP G G DPYV+++L +K +T++ RKT P +++ F F Sbjct: 296 LYVRVVKAKELPPGSITGGCDPYVEVKL---GNYKGRTKIFDRKTTIPEWNQVFAF---T 349 Query: 113 PHQIAGITLHFVVLSFDRYSRDEIIGEVVSPLSNL 147 +I L V + RD+I+G+VV L+ + Sbjct: 350 KERIQSSVLEVFVKDKETLGRDDILGKVVFDLNEI 384 Score = 37.1 bits (82), Expect = 0.015 Identities = 26/91 (28%), Positives = 49/91 (53%), Gaps = 9/91 (9%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V ++KA+ LP +TG DPYV++ L G + K +K T+ P +N+ F F Sbjct: 296 LYVRVVKAKELPPGSITGGCDPYVEVKL---GNYKGRTKIFDRKTTI-PEWNQVFAFTKE 351 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRL 279 ++ LE+ V D + + +++++G++ Sbjct: 352 RIQSSV-----LEVFVKDKETLGRDDILGKV 377 Score = 29.9 bits (64), Expect = 2.3 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 12/95 (12%) Query: 55 LVVSVVSCQNL-PGREPAGPDPYVKLQLLPDKQHKVKTRVVR-KTRCPVYDEDFTFYGIA 112 L V+V+ Q++ P PD +VK + +KT + KT P++ ED F Sbjct: 461 LRVNVIEAQDMIPSDRNRLPDVFVKASV---GMQTLKTSICSIKTTNPLWKEDLVFVVAE 517 Query: 113 PHQIAGITLHFVVLSFDRY--SRDEIIGEVVSPLS 145 P + V+ DR S+DE+IG++ P++ Sbjct: 518 PFEE-----QLVISVEDRVHTSKDEVIGKITLPMN 547 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 5/59 (8%) Query: 188 RLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFE 246 +L V ++ A+ L D G A P+V++ L +++K +T K +LNPV+N+ F+ Sbjct: 6 KLVVHVVDAQYLMPRDGQGSASPFVEVDFL---NQLSKTRTVPK--SLNPVWNQKLYFD 59 >At3g18370.1 68416.m02336 C2 domain-containing protein contains Pfam profile: PF00168 C2 domain Length = 815 Score = 41.9 bits (94), Expect = 5e-04 Identities = 62/235 (26%), Positives = 109/235 (46%), Gaps = 47/235 (20%) Query: 55 LVVSVVSCQNLPGREPAGP-DPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAP 113 ++V+V++ +NL ++ +G D VKLQ Q KT++V C V+++ F F +A Sbjct: 483 IIVTVLAGKNLVSKDKSGKCDASVKLQYGKIIQ---KTKIVNAAEC-VWNQKFEFEELAG 538 Query: 114 HQIAGITLH-----------FVVLSFDRYSRDEIIGEVVSPLSNLQLHSGEAMALCREIQ 162 + + + LS + E+ + PL ++ +SGE L + Sbjct: 539 EEYLKVKCYREEMLGTDNIGTATLSLQGINNSEM--HIWVPLEDV--NSGEIELLIEALD 594 Query: 163 PRSLKMRSAGRGEVLVSLCWQPAAARLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQR 222 P + A + L+ L VL++AR+L D+ G +DPYV++ G++ Sbjct: 595 P---EYSEADSSKGLIEL-----------VLVEARDLVAADIRGTSDPYVRVQY---GEK 637 Query: 223 IAKKKTHVKKRTLNPVFNESFVFEVPAAPNAALDHVSLELLVLDWDRVTKNEVIG 277 K++T V +TL P +N++ F P+ D SLEL V D++ + IG Sbjct: 638 --KQRTKVIYKTLQPKWNQTMEF-----PD---DGSSLELHVKDYNTLLPTSSIG 682 >At1g73580.1 68414.m08518 C2 domain-containing protein similar to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 168 Score = 41.5 bits (93), Expect = 7e-04 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 7/91 (7%) Query: 49 ENEKNALVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTF 108 +N L V V NL R+ + DPYV L+L + K+KT+VV++ P + ED +F Sbjct: 5 DNLLGILRVRVQRGVNLAVRDVSSSDPYVVLKL---GRQKLKTKVVKQNVNPQWQEDLSF 61 Query: 109 YGIAPHQIAGITLHFVVLSFDRYSRDEIIGE 139 P+ + L +V D +S+D+ +G+ Sbjct: 62 TVTDPN----LPLTLIVYDHDFFSKDDKMGD 88 >At1g66360.1 68414.m07537 C2 domain-containing protein similar to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 174 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 7/93 (7%) Query: 49 ENEKNALVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTF 108 EN L + V+ NL R+ DPYV +++ KQ K++TRV++K ++ED T Sbjct: 2 ENMLGLLRLHVIRGVNLAIRDSQSSDPYVIVRM--GKQ-KLRTRVMKKNLNTEWNEDLTL 58 Query: 109 YGIAPHQIAGITLHFVVLSFDRYSRDEIIGEVV 141 P + + +V DR+SRD+ +G+ + Sbjct: 59 SVTDP----TLPVKIMVYDRDRFSRDDKMGDAI 87 >At1g51570.1 68414.m05804 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 776 Score = 40.3 bits (90), Expect = 0.002 Identities = 34/92 (36%), Positives = 49/92 (53%), Gaps = 13/92 (14%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYL-LYNGQRIAKKKTHVKKRTLNPVFNESFVFEV 247 L V ++KA+ LP DLTG DPYV++ L Y G H +K++ NP +N+ F F Sbjct: 41 LYVRVVKAKELPGKDLTGSCDPYVEVKLGNYRG-----TTRHFEKKS-NPEWNQVFAFS- 93 Query: 248 PAAPNAALDHVSLELLVLDWDRVTKNEVIGRL 279 + LE V D D V K+++IGR+ Sbjct: 94 ----KDRVQASYLEATVKDKDLV-KDDLIGRV 120 >At1g48590.1 68414.m05433 C2 domain-containing protein similar to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 169 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/106 (27%), Positives = 53/106 (50%), Gaps = 13/106 (12%) Query: 64 NLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPHQIAGITLHF 123 NL R+ DPYV +++ + K+KTRV+ K P ++ED T P+ +T+ Sbjct: 22 NLAVRDLNSSDPYVVVKMA---KQKLKTRVIYKNVNPEWNEDLTLSVSDPN----LTVLL 74 Query: 124 VVLSFDRYSRDEIIGEV---VSPLSN---LQLHSGEAMALCREIQP 163 V +D +++D+ +G+ + P N + LH + + +QP Sbjct: 75 TVYDYDTFTKDDKMGDAEFGIKPFVNALKMHLHDLPSGTIVTTVQP 120 Score = 32.3 bits (70), Expect = 0.43 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 12/92 (13%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L + + + NL DL +DPYV + + K KT V + +NP +NE V Sbjct: 13 LRIRIKRGVNLAVRDLNS-SDPYVVVKMAKQ-----KLKTRVIYKNVNPEWNEDLTLSV- 65 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRLE 280 + PN +++ L V D+D TK++ +G E Sbjct: 66 SDPN-----LTVLLTVYDYDTFTKDDKMGDAE 92 >At5g12970.1 68418.m01487 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 769 Score = 39.5 bits (88), Expect = 0.003 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 11/91 (12%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V ++KA+ LP D+TG DPYV++ L N + + K H +KR+ NP + + F F Sbjct: 42 LYVRVVKAKELPGKDVTGSCDPYVEV-KLGNYRGMTK---HFEKRS-NPEWKQVFAFS-- 94 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRL 279 + LE++V D D V +++IGR+ Sbjct: 95 ---KERIQASILEVVVKDKD-VVLDDLIGRI 121 Score = 34.3 bits (75), Expect = 0.11 Identities = 29/94 (30%), Positives = 46/94 (48%), Gaps = 8/94 (8%) Query: 57 VSVVSCQNL-PGREPAGPDPYVKLQLLPDKQHKVKTRVVR-KTRCPVYDEDFTFYGIAPH 114 V+V+ Q+L P + P+ YVK L ++TR+ + KT P+++ED F P Sbjct: 205 VNVIEAQDLIPHDKTKFPEVYVKAML---GNQTLRTRISQTKTLNPMWNEDLMFVVAEPF 261 Query: 115 QIAGITLHFVVLSFDRYSRDEIIGEVVSPLSNLQ 148 + A L V ++DE +G PL N+Q Sbjct: 262 EEA---LILAVEDRVAPNKDETLGRCAIPLQNVQ 292 Score = 29.5 bits (63), Expect = 3.0 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 9/88 (10%) Query: 191 VVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVPAA 250 V +++A++L D T + YVK L Q + + + K TLNP++NE +F V A Sbjct: 205 VNVIEAQDLIPHDKTKFPEVYVKAML--GNQTLRTRISQTK--TLNPMWNEDLMF-VVAE 259 Query: 251 PNAALDHVSLELLVLDWDRVTKNEVIGR 278 P +L L V D K+E +GR Sbjct: 260 P----FEEALILAVEDRVAPNKDETLGR 283 >At3g57880.1 68416.m06452 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 773 Score = 39.5 bits (88), Expect = 0.003 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 13/92 (14%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYL-LYNGQRIAKKKTHVKKRTLNPVFNESFVFEV 247 L V ++KA+ LP D+TG DPYV++ L Y G H +K++ NP +N+ F F Sbjct: 41 LYVRVVKAKELPGKDMTGSCDPYVEVKLGNYKG-----TTRHFEKKS-NPEWNQVFAFS- 93 Query: 248 PAAPNAALDHVSLELLVLDWDRVTKNEVIGRL 279 + LE V D D V K+++IGR+ Sbjct: 94 ----KDRIQASFLEATVKDKDFV-KDDLIGRV 120 Score = 28.7 bits (61), Expect = 5.3 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 9/90 (10%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V +++A++L D + YVK + G + + + + RT+NP++NE +F V Sbjct: 203 LRVNVIEAQDLIPTDKQRYPEVYVKAIV---GNQALRTRVS-QSRTINPMWNEDLMF-VA 257 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGR 278 A P L L V D K+EV+GR Sbjct: 258 AEP----FEEPLILSVEDRVAPNKDEVLGR 283 >At1g53590.1 68414.m06088 C2 domain-containing protein Length = 751 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 5/57 (8%) Query: 187 ARLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESF 243 A + V + +A +L DL GLADPYVK L R KT ++K+TL+P ++E F Sbjct: 282 AHVLVEVFEASDLKPSDLNGLADPYVKGKL--GAYRF---KTKIQKKTLSPKWHEEF 333 >At3g07940.1 68416.m00971 zinc finger and C2 domain protein, putative similar to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana];contains Pfam profile: PF01412 Putative GTP-ase activating protein for Arf Length = 385 Score = 39.1 bits (87), Expect = 0.004 Identities = 34/124 (27%), Positives = 54/124 (43%), Gaps = 12/124 (9%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 + V ++K NL D+ +DPYV + L GQ+ K T V K LNPV+NE+ + +P Sbjct: 231 IKVNVVKGTNLAVRDVM-TSDPYVILAL---GQQSVK--TRVIKNNLNPVWNETLMLSIP 284 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRLELXXXXXXXXRHHWREVQAAPRRQIADWH 308 L++LV D D + ++ +G E+ + Q+ W Sbjct: 285 E------PMPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVSAAKAYETSSIKEPMQLGSWV 338 Query: 309 KLKE 312 KE Sbjct: 339 ASKE 342 Score = 39.1 bits (87), Expect = 0.004 Identities = 38/123 (30%), Positives = 55/123 (44%), Gaps = 8/123 (6%) Query: 57 VSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPHQI 116 V+VV NL R+ DPYV L L Q VKTRV++ PV++E T P + Sbjct: 233 VNVVKGTNLAVRDVMTSDPYVILAL---GQQSVKTRVIKNNLNPVWNE--TLMLSIPEPM 287 Query: 117 AGITLHFVVLSFDRYSRDEIIGEVVSPLSNLQLHSGEAMALCREIQPRSLKMRSAGRGEV 176 L +V D +S D+ +GE + L + + +A +P L A + Sbjct: 288 P--PLKVLVYDKDTFSTDDFMGEAEIDIQPL-VSAAKAYETSSIKEPMQLGSWVASKENT 344 Query: 177 LVS 179 LVS Sbjct: 345 LVS 347 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 38.7 bits (86), Expect = 0.005 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 5/75 (6%) Query: 188 RLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEV 247 +L V +++ARN+ D G + YV + ++ Q KK+T K R LNP++NE F V Sbjct: 18 KLVVEVVEARNILPKDGQGSSSAYVVVD--FDAQ---KKRTSTKFRDLNPIWNEMLDFAV 72 Query: 248 PAAPNAALDHVSLEL 262 N D + +E+ Sbjct: 73 SDPKNMDYDELDIEV 87 >At1g04150.1 68414.m00405 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1012 Score = 38.7 bits (86), Expect = 0.005 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 7/82 (8%) Query: 188 RLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEV 247 RL V ++ A NL D + P+V++ + QR+ +T VK + LNP++NE VF V Sbjct: 12 RLVVEIVGAHNLMPKDGEDSSSPFVEVQ--FENQRL---RTKVKPKDLNPIWNEKLVFHV 66 Query: 248 PAAPNAALDHVSLELLVLDWDR 269 + L H +LE+ V + R Sbjct: 67 IDVND--LRHKALEINVYNEKR 86 Score = 35.1 bits (77), Expect = 0.061 Identities = 33/125 (26%), Positives = 56/125 (44%), Gaps = 6/125 (4%) Query: 55 LVVSVVSCQNL-PGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAP 113 LVV +V NL P P+V++Q + +++T+V K P+++E F+ I Sbjct: 13 LVVEIVGAHNLMPKDGEDSSSPFVEVQF---ENQRLRTKVKPKDLNPIWNEKLVFHVIDV 69 Query: 114 HQIAGITLHFVVLSFDRYSRDEIIGEVVSPLSNLQLHSGEAMALCREIQPRSLKMRSAGR 173 + + L V + R S V L + GE++ ++ RSL S+ R Sbjct: 70 NDLRHKALEINVYNEKRSSNSRNFLGKVRVLGSSVGREGESVVQLYTLEKRSL--FSSVR 127 Query: 174 GEVLV 178 GE+ V Sbjct: 128 GEISV 132 >At4g00700.1 68417.m00096 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1006 Score = 38.3 bits (85), Expect = 0.007 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 10/80 (12%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V ++KAR+LP DLTG DPYV + + N + + TH K T +P +N+ F F Sbjct: 270 LYVRVVKARDLPNKDLTGSLDPYV-VVKIGNFKGVT---THFNKNT-DPEWNQVFAF--- 321 Query: 249 AAPNAALDHVSLELLVLDWD 268 A N L LE++V D D Sbjct: 322 AKDN--LQSNFLEVMVKDKD 339 >At4g05330.1 68417.m00815 zinc finger and C2 domain protein, putative similar to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 336 Score = 37.9 bits (84), Expect = 0.009 Identities = 31/121 (25%), Positives = 56/121 (46%), Gaps = 12/121 (9%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V + K NL D+ +DPYV + L G++ K +T V LNPV+N+ + VP Sbjct: 182 LKVTIKKGTNLAIRDMMS-SDPYVVLNL---GKQ--KLQTTVMNSNLNPVWNQELMLSVP 235 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRLELXXXXXXXXRHHWREVQAAPRRQIADWH 308 + + ++L V D+D + ++++G ++ + + + QI W Sbjct: 236 ES------YGPVKLQVYDYDTFSADDIMGEADIDIQPLITSAMAFGDPEMFGDMQIGKWL 289 Query: 309 K 309 K Sbjct: 290 K 290 Score = 35.5 bits (78), Expect = 0.046 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 7/85 (8%) Query: 55 LVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPH 114 L V++ NL R+ DPYV L L KQ K++T V+ PV++++ P Sbjct: 182 LKVTIKKGTNLAIRDMMSSDPYVVLNL--GKQ-KLQTTVMNSNLNPVWNQELMLS--VPE 236 Query: 115 QIAGITLHFVVLSFDRYSRDEIIGE 139 + L V +D +S D+I+GE Sbjct: 237 SYGPVKLQ--VYDYDTFSADDIMGE 259 >At5g61900.3 68418.m07767 copine BONZAI1 (BON1) nearly identical to BONZAI1 [Arabidopsis thaliana] GI:15487382; contains Pfam profile PF00168: C2 domain Length = 578 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/116 (22%), Positives = 49/116 (42%), Gaps = 1/116 (0%) Query: 130 RYSRDEIIGEVVSPLSNLQLHSGEAMALCREIQPRSLKMRSAGRGEVLVSLCWQPAAARL 189 + + +GE LS + S L + + G++++ A+ Sbjct: 136 KLDEQQFLGEATCALSEIITKSTRTSTLELKRKDGFAPQAQPHHGKLIIHAEESLASKIS 195 Query: 190 TVVLLKARNLPRMDLTGLADPY-VKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFV 244 T ++ + NL DL +DP+ V ++ +G I KT V+K LNP++ F+ Sbjct: 196 TEIVFRCSNLESKDLFSKSDPFLVVSKIVEHGTPIPVSKTEVRKNDLNPIWKPVFL 251 >At5g61900.1 68418.m07766 copine BONZAI1 (BON1) nearly identical to BONZAI1 [Arabidopsis thaliana] GI:15487382; contains Pfam profile PF00168: C2 domain Length = 578 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/116 (22%), Positives = 49/116 (42%), Gaps = 1/116 (0%) Query: 130 RYSRDEIIGEVVSPLSNLQLHSGEAMALCREIQPRSLKMRSAGRGEVLVSLCWQPAAARL 189 + + +GE LS + S L + + G++++ A+ Sbjct: 136 KLDEQQFLGEATCALSEIITKSTRTSTLELKRKDGFAPQAQPHHGKLIIHAEESLASKIS 195 Query: 190 TVVLLKARNLPRMDLTGLADPY-VKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFV 244 T ++ + NL DL +DP+ V ++ +G I KT V+K LNP++ F+ Sbjct: 196 TEIVFRCSNLESKDLFSKSDPFLVVSKIVEHGTPIPVSKTEVRKNDLNPIWKPVFL 251 >At3g17980.1 68416.m02287 C2 domain-containing protein similar to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 177 Score = 37.5 bits (83), Expect = 0.011 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 7/76 (9%) Query: 64 NLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPHQIAGITLHF 123 NL R+ + DPYV +++ KQ K+KTRV+ K P ++ED T + + +T+ Sbjct: 29 NLAVRDISSSDPYVVVKM--GKQ-KLKTRVINKDVNPEWNEDLTL-SVTD---SNLTVLL 81 Query: 124 VVLSFDRYSRDEIIGE 139 V D +S+D+ +G+ Sbjct: 82 TVYDHDMFSKDDKMGD 97 Score = 28.3 bits (60), Expect = 7.0 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 12/92 (13%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L + + + NL D++ +DPYV + + G++ K KT V + +NP +NE V Sbjct: 20 LRIRIKRGVNLAVRDISS-SDPYVVVKM---GKQ--KLKTRVINKDVNPEWNEDLTLSVT 73 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRLE 280 + ++++ L V D D +K++ +G E Sbjct: 74 DS------NLTVLLTVYDHDMFSKDDKMGDAE 99 >At5g50170.1 68418.m06213 C2 domain-containing protein / GRAM domain-containing protein low similarity to SP|P40748 Synaptotagmin III (SytIII) {Rattus norvegicus}; contains Pfam profiles PF00168: C2 domain, PF02893: GRAM domain Length = 1027 Score = 37.1 bits (82), Expect = 0.015 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 5/68 (7%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 LT+ L+K NL ++ T L DPYV NG+ + + VK + +P +NE F+ Sbjct: 541 LTIALIKGTNLASVEATELFDPYV--VFTCNGK---TRTSSVKLQAQDPQWNEVIEFDAM 595 Query: 249 AAPNAALD 256 P + LD Sbjct: 596 EEPPSVLD 603 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 8/54 (14%) Query: 55 LVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTF 108 L V ++ ++LP +E + KL + +HK KTRV R T P+++E+F F Sbjct: 3 LYVYILQAKDLPAKET-----FAKLHV---GRHKSKTRVARDTSSPIWNEEFVF 48 Score = 31.5 bits (68), Expect = 0.75 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 11/60 (18%) Query: 188 RLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEV 247 RL V +L+A++LP + + K+++ G+ K KT V + T +P++NE FVF + Sbjct: 2 RLYVYILQAKDLPAKET------FAKLHV---GRH--KSKTRVARDTSSPIWNEEFVFRI 50 >At2g40116.1 68415.m04933 phosphoinositide-specific phospholipase C family protein contains Pfam profile: PF00388 phosphatidylinositol-specific phospholipase C Length = 613 Score = 37.1 bits (82), Expect = 0.015 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 5/78 (6%) Query: 73 PDPYVKLQLL--PDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPHQIAGITLHFVVLSFDR 130 PD Y K+ ++ P K KT+++ P++DE+F+F P ++A L V +D Sbjct: 511 PDFYTKMFIVGVPADNAKKKTKIIEDNWYPIWDEEFSFPLTVP-ELA--LLRIEVREYDM 567 Query: 131 YSRDEIIGEVVSPLSNLQ 148 +D+ G+ P++ L+ Sbjct: 568 SEKDDFGGQTCLPVAELR 585 Score = 29.5 bits (63), Expect = 3.0 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 5/70 (7%) Query: 209 DPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVPAAPNAALDHVSLELLVLDWD 268 D Y KM+++ AKKKT + + P+++E F F + P AL L + V ++D Sbjct: 512 DFYTKMFIVGVPADNAKKKTKIIEDNWYPIWDEEFSFPL-TVPELAL----LRIEVREYD 566 Query: 269 RVTKNEVIGR 278 K++ G+ Sbjct: 567 MSEKDDFGGQ 576 >At2g01540.1 68415.m00078 C2 domain-containing protein similar to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 180 Score = 36.7 bits (81), Expect = 0.020 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 7/85 (8%) Query: 55 LVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPH 114 L + V NL R+ DPY+ L + +KTRVV+K PV++E+ T P+ Sbjct: 9 LTIHVKRGINLAIRDHRSSDPYIVLNVA---DQTLKTRVVKKNCNPVWNEEMTVAIKDPN 65 Query: 115 QIAGITLHFVVLSFDRYSRDEIIGE 139 + + V +D+++ D+ +G+ Sbjct: 66 ----VPIRLTVFDWDKFTGDDKMGD 86 Score = 35.1 bits (77), Expect = 0.061 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 12/89 (13%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 LT+ + + NL D +DPY+ + + Q + KT V K+ NPV+NE + Sbjct: 9 LTIHVKRGINLAIRDHRS-SDPYIVLNVA--DQTL---KTRVVKKNCNPVWNEEMTVAI- 61 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIG 277 PN V + L V DWD+ T ++ +G Sbjct: 62 KDPN-----VPIRLTVFDWDKFTGDDKMG 85 >At3g59660.1 68416.m06656 C2 domain-containing protein / GRAM domain-containing protein low similarity to GLUT4 vesicle protein [Rattus norvegicus] GI:4193489; contains Pfam profiles PF00168: C2 domain, PF02893: GRAM domain Length = 594 Score = 36.3 bits (80), Expect = 0.026 Identities = 27/97 (27%), Positives = 47/97 (48%), Gaps = 11/97 (11%) Query: 185 AAARLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFV 244 AA + V LL A+NL +L G +DPY ++ G K+ + + + NP++ E F Sbjct: 79 AAYIVKVELLAAKNLIGANLNGTSDPYA---IVNCGSE--KRFSSMVPGSRNPMWGEEFN 133 Query: 245 FEVPAAPNAALDHVSLELLVLDWDRVTKNEVIGRLEL 281 F P + + + DWD + K+ V+G + + Sbjct: 134 FPTDELP------AKINVTIHDWDIIWKSTVLGSVTI 164 >At3g55470.1 68416.m06160 C2 domain-containing protein similar to phloem protein GI:4164539 from [Cucurbita maxima] Length = 156 Score = 36.3 bits (80), Expect = 0.026 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 9/95 (9%) Query: 185 AAARLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRT--LNPVFNES 242 A L V L+ + L R D G DPYV+ + Y GQ +K+ V K NP +N+ Sbjct: 2 AVGILEVSLISGKGLKRSDFLGKIDPYVE--IQYKGQ---TRKSSVAKEDGGRNPTWNDK 56 Query: 243 FVFEVPAAPNAALDHVSLELLVLDWDRVTKNEVIG 277 + P + D+ L + V+D D + ++ IG Sbjct: 57 LKWRA-EFPGSGADY-KLIVKVMDHDTFSSDDFIG 89 >At5g37740.1 68418.m04543 C2 domain-containing protein similar to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 168 Score = 35.9 bits (79), Expect = 0.035 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 7/91 (7%) Query: 49 ENEKNALVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTF 108 EN L + V NL R+ + DPY+ + KQ K+KTRVV+ + P +++D T Sbjct: 2 ENLVGLLRIHVKRGVNLAIRDISSSDPYIVVHC--GKQ-KLKTRVVKHSVNPEWNDDLTL 58 Query: 109 YGIAPHQIAGITLHFVVLSFDRYSRDEIIGE 139 P+ + + V +D S D+ +GE Sbjct: 59 SVTDPN----LPIKLTVYDYDLLSADDKMGE 85 >At4g13550.1 68417.m02112 lipase class 3 family protein very low similarity to diacylglycerol lipase [Aspergillus oryzae] GI:1772352; contains Pfam profiles PF01764: Lipase (class 3), PF00168: C2 domain Length = 785 Score = 35.9 bits (79), Expect = 0.035 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 10/76 (13%) Query: 206 GLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVPAAPNAALDHVSLELLVL 265 G +DPYV M L +GQ +AK KT K T P +NE FVF + P +E+ Sbjct: 90 GTSDPYVVMDL--DGQ-VAKSKT--KWGTKEPKWNEDFVFNIKLPPAK-----KIEIAAW 139 Query: 266 DWDRVTKNEVIGRLEL 281 D + VT ++ +G E+ Sbjct: 140 DANLVTPHKRMGNSEI 155 >At3g14590.1 68416.m01847 C2 domain-containing protein low similarity to SP|Q16974 Calcium-dependent protein kinase C (EC 2.7.1.-) {Aplysia californica}; contains Pfam profile PF00168: C2 domain Length = 737 Score = 35.9 bits (79), Expect = 0.035 Identities = 29/84 (34%), Positives = 41/84 (48%), Gaps = 5/84 (5%) Query: 53 NALVVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIA 112 +ALV V +C P DPYVK QL ++ KT+++ KT P + E+F I Sbjct: 284 HALVEVVEACDVKPSDLNGLADPYVKGQL---GAYRFKTKILWKTLAPKWQEEFKI-PIC 339 Query: 113 PHQIAGITLHFVVLSFDRYSRDEI 136 A I L+ V DR+S D + Sbjct: 340 TWDSANI-LNIEVQDKDRFSDDSL 362 Score = 32.7 bits (71), Expect = 0.33 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 8/80 (10%) Query: 183 QPAAARLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKK-KTHVKKRTLNPVFNE 241 +P A L V +++A ++ DL GLADPYVK GQ A + KT + +TL P + E Sbjct: 280 EPVAHAL-VEVVEACDVKPSDLNGLADPYVK------GQLGAYRFKTKILWKTLAPKWQE 332 Query: 242 SFVFEVPAAPNAALDHVSLE 261 F + +A + ++ ++ Sbjct: 333 EFKIPICTWDSANILNIEVQ 352 >At5g06850.1 68418.m00774 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 669 Score = 34.3 bits (75), Expect = 0.11 Identities = 26/93 (27%), Positives = 47/93 (50%), Gaps = 8/93 (8%) Query: 55 LVVSVVSCQNL-PGREPAGPDPYVKLQLLPDKQHKVKTRVV-RKTRCPVYDEDFTFYGIA 112 L V+V+ Q++ P P +VK+Q+ +KT++ KT P+++ED F Sbjct: 94 LRVNVIEAQDVEPSDRSQPPQAFVKVQV---GNQILKTKLCPNKTTNPMWNEDLVFVAAE 150 Query: 113 PHQIAGITLHFVVLSFDRYSRDEIIGEVVSPLS 145 P + V + ++DE++G ++SPLS Sbjct: 151 PFEEQ---FFLTVENKVTPAKDEVMGRLISPLS 180 Score = 29.9 bits (64), Expect = 2.3 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 9/91 (9%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V +++A+++ D + +VK+ + G +I K K K T NP++NE VF V Sbjct: 94 LRVNVIEAQDVEPSDRSQPPQAFVKVQV---GNQILKTKLCPNKTT-NPMWNEDLVF-VA 148 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRL 279 A P +++E V K+EV+GRL Sbjct: 149 AEPFEEQFFLTVENKVTP----AKDEVMGRL 175 >At3g47290.1 68416.m05139 phosphoinositide-specific phospholipase C family protein similar to phosphoinositide-specific phospholipase C [Nicotiana rustica] GI:1771381, 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase [Nicotiana rustica] GI:2765140; contains Pfam profiles PF00168: C2 domain, PF00388: Phosphatidylinositol-specific phospholipase C, X domain Length = 531 Score = 32.7 bits (71), Expect = 0.33 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%) Query: 73 PDPYVKLQL--LPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPHQIAGITLHFVVLSFDR 130 PD YV++ + +P ++ +KT V P + E+FTF P +A I+ F V ++ Sbjct: 429 PDLYVRISIAGVPHDENIMKTTVKNNEWTPTWGEEFTFPLTYP-DLALIS--FEVYDYEV 485 Query: 131 YSRDEIIGEVVSPLSNL 147 + D G+ P+S L Sbjct: 486 STADAFCGQTCLPVSEL 502 >At1g70790.2 68414.m08163 C2 domain-containing protein similar to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 185 Score = 32.7 bits (71), Expect = 0.33 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 7/76 (9%) Query: 64 NLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPHQIAGITLHF 123 NL R+ DPYV + L K+KTRV+ PV++E T + + Sbjct: 18 NLAIRDATTSDPYVVITLA---NQKLKTRVINNNCNPVWNEQLTL----SIKDVNDPIRL 70 Query: 124 VVLSFDRYSRDEIIGE 139 V DR+S D+ +G+ Sbjct: 71 TVFDKDRFSGDDKMGD 86 Score = 28.7 bits (61), Expect = 5.3 Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 12/93 (12%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V + + NL D T +DPYV + L K KT V NPV+NE + Sbjct: 9 LRVHVKRGINLAIRDAT-TSDPYVVITLANQ-----KLKTRVINNNCNPVWNEQLTLSIK 62 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRLEL 281 + + L V D DR + ++ +G E+ Sbjct: 63 DVND------PIRLTVFDKDRFSGDDKMGDAEI 89 >At1g70790.1 68414.m08162 C2 domain-containing protein similar to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 185 Score = 32.7 bits (71), Expect = 0.33 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 7/76 (9%) Query: 64 NLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPHQIAGITLHF 123 NL R+ DPYV + L K+KTRV+ PV++E T + + Sbjct: 18 NLAIRDATTSDPYVVITLA---NQKLKTRVINNNCNPVWNEQLTL----SIKDVNDPIRL 70 Query: 124 VVLSFDRYSRDEIIGE 139 V DR+S D+ +G+ Sbjct: 71 TVFDKDRFSGDDKMGD 86 Score = 28.7 bits (61), Expect = 5.3 Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 12/93 (12%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L V + + NL D T +DPYV + L K KT V NPV+NE + Sbjct: 9 LRVHVKRGINLAIRDAT-TSDPYVVITLANQ-----KLKTRVINNNCNPVWNEQLTLSIK 62 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIGRLEL 281 + + L V D DR + ++ +G E+ Sbjct: 63 DVND------PIRLTVFDKDRFSGDDKMGDAEI 89 >At1g44120.1 68414.m05096 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2114 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 5/56 (8%) Query: 226 KKTHVKKRTLNPVFNESFVFEVPAAPNAALDHVSLELLVLDWDRVTKNEVIGRLEL 281 KKT V KR+ +PV+ ESF ++ A P LE +V + + +N+ +G++ + Sbjct: 2022 KKTKVVKRSSSPVWKESFTWDFAAPPRGQF----LE-IVCKSNNIFRNKNLGKVRI 2072 Score = 30.3 bits (65), Expect = 1.7 Identities = 28/103 (27%), Positives = 51/103 (49%), Gaps = 6/103 (5%) Query: 80 QLLPDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPHQIAGITLHFVVLSFDRYSRDEIIGE 139 +L+ D KT+VV+++ PV+ E FT+ AP + G L V S + R++ +G+ Sbjct: 2013 RLIIDNCPTKKTKVVKRSSSPVWKESFTWDFAAPPR--GQFLEIVCKS-NNIFRNKNLGK 2069 Query: 140 VVSPLSNLQLHSGEAMALCREIQPRSLKMRSAGRGEVLVSLCW 182 V P+ + L G + + + S K S+ R + + + W Sbjct: 2070 VRIPIDKV-LSEGSYSGIFK-LNDESKKDNSSDR-SLEIEIVW 2109 >At1g63220.1 68414.m07146 C2 domain-containing protein similar to phloem protein RPP16 [Oryza sativa (japonica cultivar-group)] GI:21998839; contains Pfam profile PF00168: C2 domain Length = 147 Score = 30.3 bits (65), Expect = 1.7 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 10/89 (11%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNESFVFEVP 248 L VVL+ A+ L D DPYV++ Q K + P +NE+F+F V Sbjct: 6 LEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQ----KSNVAEGMGTTPEWNETFIFTVS 61 Query: 249 AAPNAALDHVSLELLVLDWDRVTKNEVIG 277 L+ + D D T+++ +G Sbjct: 62 EGT------TELKAKIFDKDVGTEDDAVG 84 >At3g19830.1 68416.m02512 C2 domain-containing protein low similarity to GLUT4 vesicle protein [Rattus norvegicus] GI:4193489; contains Pfam profile PF00168: C2 domain Length = 666 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 5/65 (7%) Query: 55 LVVSVVSCQNLPGREPAGPDPYVKL----QLLPDKQHKVKTRVVRKTRCPVYDEDFTFYG 110 L V++V+ Q LP DPYV L Q++ K++ +T V+ P++++DF F Sbjct: 388 LSVTLVNAQKLPYMFSGKTDPYVILRIGDQVIRSKKNS-QTTVIGAPGQPIWNQDFQFLV 446 Query: 111 IAPHQ 115 P + Sbjct: 447 SNPRE 451 >At1g08230.1 68414.m00909 amino acid transporter family protein low similarity to amino acid permease [Oryza sativa] GI:7415521; contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 332 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/48 (27%), Positives = 26/48 (54%) Query: 176 VLVSLCWQPAAARLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRI 223 +L+ L + +AA ++ + K N P D T + DP +++ ++N I Sbjct: 65 LLLCLLYSASAAAASIYIGKEPNAPEKDYTIVGDPETRVFGIFNAMAI 112 >At5g18480.1 68418.m02179 glycogenin glucosyltransferase (glycogenin)-related low similarity to glycogenin-1 from Mus musculus [SP|Q9R062], Rattus norvegicus [SP|O08730], Homo sapiens [SP|P46976]; contains Pfam profile PF01501: Glycosyl transferase family 8 Length = 537 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Query: 189 LTVVLLKARNLPRMD-LTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPV 238 +T +LK R +P M+ L+ L + V +Y+L N + K HV TL P+ Sbjct: 204 VTPEVLKTRPVPAMERLSTLYNADVGLYMLANKWMVDDSKLHVIHYTLGPL 254 >At5g47710.1 68418.m05891 C2 domain-containing protein contains similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 166 Score = 29.1 bits (62), Expect = 4.0 Identities = 32/95 (33%), Positives = 44/95 (46%), Gaps = 16/95 (16%) Query: 189 LTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNE--SFVFE 246 L V +++ + L D +DPYV + L G AK K V LNPV+NE +F + Sbjct: 8 LQVTVIQGKKLVIRDFKS-SDPYVIVKL---GNESAKTK--VINNCLNPVWNEELNFTLK 61 Query: 247 VPAAPNAALDHVSLELLVLDWDRVTKNEVIGRLEL 281 PAA L L V D DR ++ +G L Sbjct: 62 DPAA--------VLALEVFDKDRFKADDKMGHASL 88 >At2g21040.1 68415.m02495 C2 domain-containing protein low similarity to phloem protein [Cucurbita maxima] GI:4164541; contains Pfam profile PF00168: C2 domain Length = 261 Score = 29.1 bits (62), Expect = 4.0 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 11/79 (13%) Query: 184 PAAARLTVVLLKARNLPRMDLTGL--ADPYVKMYLLYNGQRIAKKKTHVKKRTLNPVFNE 241 PAA + VV++ + D+ G +PYV +Y + G+ +K HVKK +P +NE Sbjct: 12 PAAGGMFVVIVHSAE----DVEGKHHTNPYVHIY--FKGEE--RKTKHVKKNK-DPKWNE 62 Query: 242 SFVFEVPAAPNAALDHVSL 260 F F + P HV + Sbjct: 63 EFSFMLEEPPIHEKMHVKV 81 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 5/53 (9%) Query: 56 VVSVVSCQNLPGREPAGPDPYVKLQLLPDKQHKVKTRVVRKTRCPVYDEDFTF 108 VV V S +++ G+ +PYV + K + KT+ V+K + P ++E+F+F Sbjct: 19 VVIVHSAEDVEGKHHT--NPYVHIYF---KGEERKTKHVKKNKDPKWNEEFSF 66 >At1g08860.1 68414.m00987 copine, putative Similar to BONZAI1 [Arabidopsis thaliana] GI:15487382; contains Pfam profile PF00168: C2 domain Length = 589 Score = 29.1 bits (62), Expect = 4.0 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Query: 194 LKARNLPRMDLTGLADPYVKMYLLYNGQRIAK-KKTHVKKRTLNPVFNE----SFVFE 246 L A NL D+T +DP MYL R+ + +T V LNP + E SF FE Sbjct: 63 LSASNLLDCDITSKSDPMAVMYLRKKDGRLEEIGRTEVILNNLNPKWIEKITVSFQFE 120 >At5g40480.1 68418.m04909 expressed protein ; expression supported by MPSS Length = 1919 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/43 (39%), Positives = 23/43 (53%) Query: 109 YGIAPHQIAGITLHFVVLSFDRYSRDEIIGEVVSPLSNLQLHS 151 YGI + GI VV +FD + DE+I EV P S + L + Sbjct: 519 YGIIQAKRPGIATVKVVSTFDSQNFDEVIVEVSIPSSMVMLQN 561 >At1g55320.1 68414.m06319 acyl-activating enzyme 18 (AAE18) nearly identical to acyl-activating enzyme 18 [Arabidopsis thaliana] GI:29893268; similar to acetyl-CoA synthetase [SP|P27095] from Methanothrix soehngenii; contains Pfam AMP-binding enzyme domain PF00501l; identical to cDNA acyl-activating enzyme 18 (At1g55320) GI: 29893267 Length = 725 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Query: 219 NGQRIAKKKTHVKKRTLNPVFNESFVFEVPAAPNAA 254 +G+ + K + ++ LNP+F SFV VP P A Sbjct: 666 SGEELKMKFSRTIQKDLNPLFKVSFVKIVPEFPRTA 701 >At5g58700.1 68418.m07354 phosphoinositide-specific phospholipase C family protein contains Pfam profile: PF00388 phosphatidylinositol-specific phospholipase C Length = 597 Score = 27.9 bits (59), Expect = 9.2 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 5/78 (6%) Query: 73 PDPYVKLQLL--PDKQHKVKTRVVRKTRCPVYDEDFTFYGIAPHQIAGITLHFVVLSFDR 130 PD +V++ + P + KT++ T P+++++FTF +A ++A L V D Sbjct: 495 PDFFVRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFTF-PLAVPELA--LLRVEVHEHDV 551 Query: 131 YSRDEIIGEVVSPLSNLQ 148 +D+ G+ P+S ++ Sbjct: 552 NEKDDFGGQTCLPVSEIR 569 >At5g42870.1 68418.m05225 lipin family protein contains Pfam profile: PF04571 lipin, N-terminal conserved region Length = 930 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Query: 182 WQPAAARLTVVLLKARNLPRMDLTGLADPYVKMYLLYNGQ 221 W + VL RNL R+D+ G+ D MYL + GQ Sbjct: 46 WYVRFGKFQGVLKNGRNLIRIDVNGV-DSGFNMYLAHTGQ 84 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.323 0.139 0.431 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,387,523 Number of Sequences: 28952 Number of extensions: 305984 Number of successful extensions: 662 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 30 Number of HSP's that attempted gapping in prelim test: 558 Number of HSP's gapped (non-prelim): 119 length of query: 312 length of database: 12,070,560 effective HSP length: 81 effective length of query: 231 effective length of database: 9,725,448 effective search space: 2246578488 effective search space used: 2246578488 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -