BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001588-TA|BGIBMGA001588-PA|undefined (171 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0383 + 7966929-7968951,7969085-7969104 31 0.49 10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 30 1.1 05_05_0338 + 24204301-24206262,24206337-24206495,24206864-242070... 27 8.0 >03_02_0383 + 7966929-7968951,7969085-7969104 Length = 680 Score = 31.1 bits (67), Expect = 0.49 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Query: 50 SLSHKLGSKRCPDKALVFQPPRRATAVRSPGSATHYL 86 SL L KRCP+ LV + PRR R +A HYL Sbjct: 206 SLQDALLGKRCPE--LVSEWPRRLAVARDVAAALHYL 240 >10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 Length = 746 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Query: 50 SLSHKLGSKRCPDKALVFQPPRRATAVRSPGSATHYL 86 SL L +RCP+ LV + PRR R +A HYL Sbjct: 211 SLQDALLGRRCPE--LVAEWPRRLAVARDVAAALHYL 245 >05_05_0338 + 24204301-24206262,24206337-24206495,24206864-24207035, 24207544-24207842,24208301-24208355,24208438-24208487, 24208522-24208827 Length = 1000 Score = 27.1 bits (57), Expect = 8.0 Identities = 11/41 (26%), Positives = 24/41 (58%) Query: 22 IWVMTVVLGTILLALCVGIACWIVRFKSSLSHKLGSKRCPD 62 +W+++VV+G+I + + V + C V F + + G + P+ Sbjct: 955 LWLLSVVIGSISMIISVILKCIPVEFNKTNTKPHGYELIPE 995 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.322 0.135 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,387,318 Number of Sequences: 37544 Number of extensions: 94623 Number of successful extensions: 218 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 217 Number of HSP's gapped (non-prelim): 3 length of query: 171 length of database: 14,793,348 effective HSP length: 77 effective length of query: 94 effective length of database: 11,902,460 effective search space: 1118831240 effective search space used: 1118831240 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -