SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001588-TA|BGIBMGA001588-PA|undefined
         (171 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z70687-1|CAA94616.3|  403|Caenorhabditis elegans Hypothetical pr...    27   7.1  

>Z70687-1|CAA94616.3|  403|Caenorhabditis elegans Hypothetical
           protein T14C1.1 protein.
          Length = 403

 Score = 27.1 bits (57), Expect = 7.1
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 12  GSAGGLETDTIWVMTVVLGTILLALCVGIACWIVRFKSSLSHKLGSK 58
           GS+     DT   M+++L  +L   C  IA  I  F+S LS  LGSK
Sbjct: 277 GSSASNMDDT---MSLILVVLLFICCNTIALVINIFESYLSETLGSK 320


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.322    0.135    0.411 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,606,337
Number of Sequences: 27539
Number of extensions: 68189
Number of successful extensions: 127
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 126
Number of HSP's gapped (non-prelim): 1
length of query: 171
length of database: 12,573,161
effective HSP length: 77
effective length of query: 94
effective length of database: 10,452,658
effective search space: 982549852
effective search space used: 982549852
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 56 (26.6 bits)

- SilkBase 1999-2023 -