BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001588-TA|BGIBMGA001588-PA|undefined (171 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70687-1|CAA94616.3| 403|Caenorhabditis elegans Hypothetical pr... 27 7.1 >Z70687-1|CAA94616.3| 403|Caenorhabditis elegans Hypothetical protein T14C1.1 protein. Length = 403 Score = 27.1 bits (57), Expect = 7.1 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Query: 12 GSAGGLETDTIWVMTVVLGTILLALCVGIACWIVRFKSSLSHKLGSK 58 GS+ DT M+++L +L C IA I F+S LS LGSK Sbjct: 277 GSSASNMDDT---MSLILVVLLFICCNTIALVINIFESYLSETLGSK 320 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.322 0.135 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,606,337 Number of Sequences: 27539 Number of extensions: 68189 Number of successful extensions: 127 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 126 Number of HSP's gapped (non-prelim): 1 length of query: 171 length of database: 12,573,161 effective HSP length: 77 effective length of query: 94 effective length of database: 10,452,658 effective search space: 982549852 effective search space used: 982549852 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -