BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001587-TA|BGIBMGA001587-PA|IPR000533|Tropomyosin, IPR009053|Prefoldin (284 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 29 0.030 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 29 0.052 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 29 0.052 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 25 0.64 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 25 0.64 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 25 0.64 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 25 0.85 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 25 0.85 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 24 1.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.5 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 6.0 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 29.5 bits (63), Expect = 0.030 Identities = 23/94 (24%), Positives = 44/94 (46%), Gaps = 9/94 (9%) Query: 72 EEKEKQLTATEAEVAALNRKVQQIEEDLEKSEERSGTAQQKLLEAQQSADENNRMCKVLE 131 ++ +K + A + + L R+V++ + DL + + T + L + S + L Sbjct: 74 QKHKKDIRADKKALQKLRREVEKAKRDLSSVHKTTLTIENLLADYDFS--------ETL- 124 Query: 132 NRAQQDEERMDQLTNQLKEARLLAEDADGKSDEV 165 RA+ +E DQ LK + + EDAD D++ Sbjct: 125 TRAKFEELNNDQFLKTLKPVKKVLEDADMTKDQI 158 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 28.7 bits (61), Expect = 0.052 Identities = 26/112 (23%), Positives = 51/112 (45%), Gaps = 6/112 (5%) Query: 109 AQQKLLEAQQSADENNRMCKVLENRAQQDEERMDQLTNQLKEARLLAEDADGKSDEVSRK 168 A QK+ E + ++ +++ L AQ DE ++ N+L + + AD K +E RK Sbjct: 1047 AVQKIEE--KKPEKKDKVLTFLGANAQDDEGGLEFSVNKLFKCMICTYKADNKENEQLRK 1104 Query: 169 LAFVEDELEVAEDRVKSGDAKISELEEELKVVGNSLKSLEVSEEKANQRVEE 220 +++ L +++S + K+ + V N +E S+ VE+ Sbjct: 1105 ---IQESLRDLNRKIESLE-KMQYPDLRSPAVSNVTTFMEGSKATVKNNVED 1152 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 28.7 bits (61), Expect = 0.052 Identities = 26/112 (23%), Positives = 51/112 (45%), Gaps = 6/112 (5%) Query: 109 AQQKLLEAQQSADENNRMCKVLENRAQQDEERMDQLTNQLKEARLLAEDADGKSDEVSRK 168 A QK+ E + ++ +++ L AQ DE ++ N+L + + AD K +E RK Sbjct: 1047 AVQKIEE--KKPEKKDKVLTFLGANAQDDEGGLEFSVNKLFKCMICTYKADNKENEQLRK 1104 Query: 169 LAFVEDELEVAEDRVKSGDAKISELEEELKVVGNSLKSLEVSEEKANQRVEE 220 +++ L +++S + K+ + V N +E S+ VE+ Sbjct: 1105 ---IQESLRDLNRKIESLE-KMQYPDLRSPAVSNVTTFMEGSKATVKNNVED 1152 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 25.0 bits (52), Expect = 0.64 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 12/75 (16%) Query: 72 EEKEKQLTATEAEVAALNRKVQQIEED---LEKSEERSGTAQQKLLEAQQSADENNRMCK 128 E++EK + T A+ NRK ++ LE S E+SG K ++ S DE Sbjct: 120 EKEEKDMETTLTPCASPNRKPDDNQDHLRRLEMSLEKSGLFSSK--TSEHSVDE------ 171 Query: 129 VLENRAQQDEERMDQ 143 L ++ D E D+ Sbjct: 172 -LSGKSDNDAEEYDE 185 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 25.0 bits (52), Expect = 0.64 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Query: 54 EEDLILNKNKLEQANKDLEEKEKQLTATEAEVAALNR--KVQQIEEDLEKSEERS 106 E L L++NKL++ N D LT +A+ N+ QQ + + +EE S Sbjct: 106 ETSLQLDENKLDKKNDDSPALRALLTRPQAKKTPPNQYENFQQYDNNNFSAEENS 160 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 25.0 bits (52), Expect = 0.64 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Query: 54 EEDLILNKNKLEQANKDLEEKEKQLTATEAEVAALNR--KVQQIEEDLEKSEERS 106 E L L++NKL++ N D LT +A+ N+ QQ + + +EE S Sbjct: 106 ETSLQLDENKLDKKNDDSPALRALLTRPQAKKTPPNQYENFQQYDNNNFSAEENS 160 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 24.6 bits (51), Expect = 0.85 Identities = 12/22 (54%), Positives = 15/22 (68%) Query: 66 QANKDLEEKEKQLTATEAEVAA 87 QA K+L E+EKQ A +A AA Sbjct: 283 QAIKELNEQEKQAQAQKAAAAA 304 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 24.6 bits (51), Expect = 0.85 Identities = 12/22 (54%), Positives = 15/22 (68%) Query: 66 QANKDLEEKEKQLTATEAEVAA 87 QA K+L E+EKQ A +A AA Sbjct: 65 QAIKELNEQEKQAQAQKAAAAA 86 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 24.2 bits (50), Expect = 1.1 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Query: 88 LNRKVQQIEEDLEKSEERSGTAQQKLLEAQQSADENNRMCKVLEN 132 LNR+V QI++D+E + S + + + DE R + EN Sbjct: 294 LNREVDQIKQDVEDLKRWSDRIYAAIHQGSVT-DERGRSITLTEN 337 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/28 (32%), Positives = 19/28 (67%) Query: 87 ALNRKVQQIEEDLEKSEERSGTAQQKLL 114 A+ + +++EE+ +++EE A+QK L Sbjct: 1065 AVKKTKKELEEEKKQAEEAKRKAKQKSL 1092 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/28 (32%), Positives = 19/28 (67%) Query: 87 ALNRKVQQIEEDLEKSEERSGTAQQKLL 114 A+ + +++EE+ +++EE A+QK L Sbjct: 1065 AVKKTKKELEEEKKQAEEAKRKAKQKSL 1092 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/28 (32%), Positives = 19/28 (67%) Query: 87 ALNRKVQQIEEDLEKSEERSGTAQQKLL 114 A+ + +++EE+ +++EE A+QK L Sbjct: 1065 AVKKTKKELEEEKKQAEEAKRKAKQKSL 1092 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/28 (32%), Positives = 19/28 (67%) Query: 87 ALNRKVQQIEEDLEKSEERSGTAQQKLL 114 A+ + +++EE+ +++EE A+QK L Sbjct: 1065 AVKKTKKELEEEKKQAEEAKRKAKQKSL 1092 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/51 (23%), Positives = 22/51 (43%) Query: 100 EKSEERSGTAQQKLLEAQQSADENNRMCKVLENRAQQDEERMDQLTNQLKE 150 +K++E G K ++ EN+ K+ +DE+ +N KE Sbjct: 855 DKAQEADGEVVVKKEVDEEERLENHTSVKIKREAEDRDEDERSFHSNGAKE 905 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.303 0.121 0.298 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,100 Number of Sequences: 317 Number of extensions: 1594 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of query: 284 length of database: 114,650 effective HSP length: 56 effective length of query: 228 effective length of database: 96,898 effective search space: 22092744 effective search space used: 22092744 T: 11 A: 40 X1: 17 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -