BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001585-TA|BGIBMGA001585-PA|IPR000533|Tropomyosin, IPR010978|tRNA-binding arm, IPR009053|Prefoldin (257 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 26 0.29 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 26 0.29 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 26 0.39 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 26 0.39 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 26 0.39 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 26 0.39 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 26 0.39 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 26 0.39 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 26 0.39 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 25 0.51 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 25 0.51 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 25 0.51 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 25 0.68 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 25 0.68 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 25 0.90 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 25 0.90 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 25 0.90 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 25 0.90 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 25 0.90 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 25 0.90 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 25 0.90 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 25 0.90 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 25 0.90 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 25 0.90 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 25 0.90 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 24 1.2 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 24 1.2 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 24 1.2 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 24 1.2 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 24 1.2 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 24 1.2 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 24 1.2 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 24 1.2 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 24 1.2 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 24 1.2 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 24 1.2 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 1.2 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 1.2 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 24 1.2 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 24 1.2 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 24 1.2 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.2 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 24 1.6 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 24 1.6 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 24 1.6 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 24 1.6 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 24 1.6 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 24 1.6 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 24 1.6 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 24 1.6 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 24 1.6 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 24 1.6 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 24 1.6 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 2.7 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 23 2.7 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 2.7 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 2.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 2.7 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 4.8 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 4.8 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 4.8 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 4.8 M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-... 22 6.3 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 6.3 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 6.3 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 6.3 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 6.3 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 6.3 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 6.3 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 6.3 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 6.3 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 6.3 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 6.3 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 6.3 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 6.3 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 6.3 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 8.4 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 8.4 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 8.4 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 8.4 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 8.4 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 26.2 bits (55), Expect = 0.29 Identities = 11/36 (30%), Positives = 21/36 (58%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYETHL 129 E+ + + E EY+ +T R ++ T+RE + ET + Sbjct: 268 EQNSYKNEREYRKYRETSKGRSRDRTERERSKETKI 303 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 26.2 bits (55), Expect = 0.29 Identities = 11/36 (30%), Positives = 21/36 (58%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYETHL 129 E+ + + E EY+ +T R ++ T+RE + ET + Sbjct: 279 EQNSYKNEREYRKYRETSKGRSRDRTERERSKETKI 314 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.8 bits (54), Expect = 0.39 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ KT R ++ T+RE + E Sbjct: 46 EQKSYKNENSYRKYRKTSKERSRDRTERERSKE 78 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.8 bits (54), Expect = 0.39 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ KT R ++ T+RE + E Sbjct: 46 EQKSYKNENSYRKYRKTSKERSRDRTERERSKE 78 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.8 bits (54), Expect = 0.39 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ KT R ++ T+RE + E Sbjct: 46 EQKSYKNENSYRKYRKTSKERSRDRTERERSKE 78 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.8 bits (54), Expect = 0.39 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ KT R ++ T+RE + E Sbjct: 46 EQKSYKNENSYRKYRKTSKERSRDRTERERSKE 78 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.8 bits (54), Expect = 0.39 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ KT R ++ T+RE + E Sbjct: 46 EQKSYKNENSYRKYRKTSKERSRDRTERERSKE 78 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.8 bits (54), Expect = 0.39 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ KT R ++ T+RE + E Sbjct: 46 EQKSYKNENSYRKYRKTSKERSRDRTERERSKE 78 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 25.8 bits (54), Expect = 0.39 Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E EY+ +T R ++ T+RE + E Sbjct: 279 EQKSYKNEREYRKYGETSKERSRDRTERERSKE 311 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 25.4 bits (53), Expect = 0.51 Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E EY+ +T R ++ T+RE + E Sbjct: 46 EQKSYKNEREYRKYRETSKERSQDRTERETSKE 78 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 25.4 bits (53), Expect = 0.51 Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E EY+ +T R ++ T+RE + E Sbjct: 46 EQKSYKNEREYRKYRETSKERSQDRTERETSKE 78 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.4 bits (53), Expect = 0.51 Identities = 10/36 (27%), Positives = 21/36 (58%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYETHL 129 E+K+ + E EY+ +T R ++ +RE + E+ + Sbjct: 279 EQKSYKNEREYRKYRETSKERFRDRRERERSKESKI 314 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 0.68 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 75 ELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 +L EE N +S E E+ + + E EY+ +T R ++ T+RE + E Sbjct: 27 KLLEERTNRKRNSRSRE-REQNSYKNEREYRKYRETSKERSRDRTERERSRE 77 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.0 bits (52), Expect = 0.68 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E EY+ KT R ++ +RE + E Sbjct: 268 EQKSYKNEREYRKYGKTSKERSRDRMERERSKE 300 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.6 bits (51), Expect = 0.90 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + E EY+ +T R + T+RE++ E Sbjct: 46 EQKLYKNEREYRKYGETSKERSRNRTEREKSKE 78 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.6 bits (51), Expect = 0.90 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + E EY+ +T R + T+RE++ E Sbjct: 46 EQKLYKNEREYRKYGETSKERSRNRTEREKSKE 78 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.6 bits (51), Expect = 0.90 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + E EY+ +T R + T+RE++ E Sbjct: 46 EQKLYKNEREYRKYGETSKERSRNRTEREKSKE 78 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.6 bits (51), Expect = 0.90 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + E EY+ +T R + T+RE++ E Sbjct: 46 EQKLYKNEREYRKYGETSKERSRNRTEREKSKE 78 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 24.6 bits (51), Expect = 0.90 Identities = 10/33 (30%), Positives = 20/33 (60%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E+EY+ +T R ++ T+RE + E Sbjct: 46 EQNSYKNEKEYRKYRETSKERSRDRTERERSRE 78 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.6 bits (51), Expect = 0.90 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + E EY+ +T R + T+RE++ E Sbjct: 279 EQKLYKNEREYRKYGETSKERSRNRTEREKSKE 311 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 0.90 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + E EY+ +T R + T+RE++ E Sbjct: 279 EQKLYKNEREYRKYGETSKERSRNRTEREKSKE 311 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 0.90 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + E EY+ +T R + T+RE++ E Sbjct: 279 EQKLYKNEREYRKYGETSKERSRNRTEREKSKE 311 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 0.90 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + E EY+ +T R + T+RE++ E Sbjct: 279 EQKLYKNEREYRKYGETSKERSRNRTEREKSKE 311 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 0.90 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + E EY+ +T R + T+RE++ E Sbjct: 279 EQKLYKNEREYRKYGETSKERSRNRTEREKSKE 311 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 24.6 bits (51), Expect = 0.90 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + E EY+ +T R + T+RE++ E Sbjct: 268 EQKLYKNEREYRKYGETSKERSRNRTEREKSKE 300 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ T+RE + E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRTERERSRE 78 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ T+RE + E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRTERERSRE 78 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ T+RE + E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRTERERSRE 78 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ T+RE + E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRTERERSRE 78 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ T+RE + E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRTERERSRE 78 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ T+RE + E Sbjct: 46 EQKSYKNENSYRKYRETSKERSRDRTERERSRE 78 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ T+RE + E Sbjct: 46 EQKSYKNENSYRKYRETWKERSRDRTERERSRE 78 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ T+RE + E Sbjct: 46 EQKSYKNENSYRKYRETWKERSRDRTERERSRE 78 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ T+RE + E Sbjct: 46 EQKSYKNENSYRKYRETWKERSRDRTERERSRE 78 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ T+RE + E Sbjct: 46 EQKSYKNENSYRKYRETWKERSRDRTERERSRE 78 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ T+RE + E Sbjct: 268 EQKSYKNENSYRKYRETSKERSRDRTERERSRE 300 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ T+RE + E Sbjct: 279 EQKSYKNENSYRKYRETSKERSRDRTERERSRE 311 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ T+RE + E Sbjct: 279 EQKSYKNENSYRKYRETSKERSRDRTERERSRE 311 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ T+RE + E Sbjct: 268 EQKSYKNENSYRKYRETSKERSRDRTERERSRE 300 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ T+RE + E Sbjct: 279 EQKSYKNENSYRKYRETSKERSRDRTERERSKE 311 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ T+RE + E Sbjct: 284 EQKSYKNENSYRKYRETSKERSRDKTERERSKE 316 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ T+RE + E Sbjct: 279 EQKSYKNENSYRKYRETSKERSRDRTERERSRE 311 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/48 (27%), Positives = 21/48 (43%) Query: 79 ELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E R N E+ + + E EY+ +T R ++ T+RE E Sbjct: 31 EERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKE 78 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/48 (27%), Positives = 21/48 (43%) Query: 79 ELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E R N E+ + + E EY+ +T R ++ T+RE E Sbjct: 31 EERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKE 78 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/48 (27%), Positives = 21/48 (43%) Query: 79 ELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E R N E+ + + E EY+ +T R ++ T+RE E Sbjct: 31 EERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKE 78 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/48 (27%), Positives = 21/48 (43%) Query: 79 ELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E R N E+ + + E EY+ +T R ++ T+RE E Sbjct: 31 EERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKE 78 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/48 (27%), Positives = 21/48 (43%) Query: 79 ELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E R N E+ + + E EY+ +T R ++ T+RE E Sbjct: 31 EERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKE 78 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/48 (27%), Positives = 21/48 (43%) Query: 79 ELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E R N E+ + + E EY+ +T R ++ T+RE E Sbjct: 31 EERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKE 78 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/48 (27%), Positives = 21/48 (43%) Query: 79 ELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E R N E+ + + E EY+ +T R ++ T+RE E Sbjct: 31 EERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKE 78 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E EY+ +T R ++ +RE + E Sbjct: 46 EQKSYKNEREYREYRETSRERSRDRKERERSKE 78 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E EY+ +T R ++ +RE + E Sbjct: 46 EQKSYKNEREYREYRETSRERSRDRKERERSKE 78 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E EY+ +T R ++ +RE + E Sbjct: 46 EQKSYKNEREYREYRETSRERSRDRKERERSKE 78 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E EY+ +T R ++ +RE + E Sbjct: 46 EQKSYKNEREYREYRETSRERSRDRKERERSKE 78 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + + EY+ +T R + T+RE + E Sbjct: 46 EQKLYKNKREYRKYRETSKERSRNRTERERSKE 78 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + + EY+ +T R + T+RE + E Sbjct: 46 EQKLYKNKREYRKYRETSKERSRNRTERERSKE 78 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.7 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Query: 75 ELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 +L EE N +S E E+ + + E EY+ +T R ++ +RE + E Sbjct: 27 KLLEERTNRKRNSRSRE-REQNSYKNEREYRKYRETSKERSRDRAERERSRE 77 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + + EY+ +T R + T+RE + E Sbjct: 46 EQKLYKNKREYRKYRETSKERSRNRTERERSKE 78 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + + EY+ +T R + T+RE + E Sbjct: 46 EQKLYKNKREYRKYRETSKERSRNRTERERSKE 78 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + + EY+ +T R + T+RE + E Sbjct: 46 EQKLYKNKREYRKYRETSKERSRNRTERERSKE 78 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + + EY+ +T R + T+RE + E Sbjct: 46 EQKLYKNKREYRKYRETSKERSRNRTERERSKE 78 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + + EY+ +T R + T+RE + E Sbjct: 46 EQKLYKNKREYRKYRETSKERSRNRTERERSKE 78 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + + EY+ +T R + T+RE + E Sbjct: 46 EQKLYKNKREYRKYRETSKERSRNRTERERSKE 78 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + + EY+ +T R + T+RE + E Sbjct: 46 EQKLYKNKREYRKYRETSKERSRNRTERERSKE 78 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + + EY+ +T R + T+RE + E Sbjct: 46 EQKLYKNKREYRKYRETSKERSRNRTERERSKE 78 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + + EY+ +T R + T+RE + E Sbjct: 279 EQKLYKNKREYRKYRETSKERSRNRTERERSKE 311 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K + + EY+ +T R + T+RE + E Sbjct: 279 EQKLYKNKREYRKYRETSKERSRNRTERERSKE 311 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/33 (27%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ +RE++ E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRKEREKSKE 78 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/33 (27%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ +RE++ E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRKEREKSKE 78 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/33 (27%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ +RE++ E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRKEREKSKE 78 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/33 (27%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E +Y+ + R ++ T+RE + E Sbjct: 46 EQKSYKNERKYRKYRERSKERSRDRTERERSRE 78 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/33 (27%), Positives = 19/33 (57%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E +Y+ + R ++ T+RE + E Sbjct: 46 EQKSYKNERKYRKYRERSKERSRDRTERERSRE 78 >M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H40. ). Length = 74 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/29 (34%), Positives = 17/29 (58%) Query: 10 RKVLENRSLADEERMDALENQLKEARFLA 38 R+ R+ E++ ALEN+ K R+L+ Sbjct: 6 REARRARTAFTYEQLVALENKFKTTRYLS 34 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ +RE + E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRRERERSKE 78 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ +RE + E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRRERERSKE 78 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ +RE + E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRRERERSKE 78 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ +RE + E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRRERERSKE 78 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ +RE + E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRRERERSKE 78 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ +RE + E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRRERERSKE 78 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ +RE + E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRRERERSKE 78 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ +RE + E Sbjct: 46 EQNSYKNEREYRKYRETSKERSRDRRERERSKE 78 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ +RE + E Sbjct: 46 EQKSYKNENSYRKYRETSKERSRDRKERERSKE 78 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ +T R ++ +RE + E Sbjct: 268 EQNSYKNEREYRKYRETSKERSRDRRERERSKE 300 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ +RE + E Sbjct: 279 EQKSYKNENSYRKYRETSKERSRDRKERERSKE 311 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+ + + E EY+ + R ++ T+RE + E Sbjct: 279 EQNSYKNEREYRKYRERSKERSRDRTERERSRE 311 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 15 NRSLADEERMDALENQLKEARFLAEEADKKYD 46 NR + D R+DA+ + ++AR L E + + D Sbjct: 214 NRGV-DGFRIDAINHMFEDARLLDEPSANRTD 244 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ +RE + E Sbjct: 46 EKKSYKNENSYRKYRETSKERSRDRKERERSKE 78 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ +RE + E Sbjct: 46 EKKSYKNENSYRKYRETSKERSRDRKERERSKE 78 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ +RE + E Sbjct: 46 EKKSYKNENSYRKYRETSKERSRDRKERERSKE 78 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ +RE + E Sbjct: 46 EKKSYKNENSYRKYRETSKERSRDRKERERSKE 78 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 94 EEKANQREEEYKNQIKTLTTRLKEATKREETYE 126 E+K+ + E Y+ +T R ++ +RE + E Sbjct: 279 EKKSYKNENSYRKYRETSKERSRDRKERERSKE 311 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.312 0.128 0.337 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,402 Number of Sequences: 429 Number of extensions: 2380 Number of successful extensions: 104 Number of sequences better than 10.0: 90 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 90 length of query: 257 length of database: 140,377 effective HSP length: 56 effective length of query: 201 effective length of database: 116,353 effective search space: 23386953 effective search space used: 23386953 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -