SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001584-TA|BGIBMGA001584-PA|IPR000533|Tropomyosin
         (136 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.    25   0.22 
AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    24   0.50 
L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.        21   6.2  

>AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.
          Length = 615

 Score = 25.4 bits (53), Expect = 0.22
 Identities = 15/44 (34%), Positives = 21/44 (47%)

Query: 93  RIRKALENRTNMEDDRVAILEAQLSQAKLIAEESDKKYEEVIAY 136
           R+ + L N T M D  V   + +L Q     E+SD  +  VI Y
Sbjct: 494 RVVQKLVNTTVMRDLGVEFQKIELKQCDEFVEDSDDYWNCVIQY 537


>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 24.2 bits (50), Expect = 0.50
 Identities = 8/13 (61%), Positives = 11/13 (84%)

Query: 35  YHKRLQVEIMRRE 47
           YHK LQ+E++R E
Sbjct: 156 YHKELQIELVREE 168


>L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.
          Length = 382

 Score = 20.6 bits (41), Expect = 6.2
 Identities = 7/12 (58%), Positives = 11/12 (91%)

Query: 36  HKRLQVEIMRRE 47
           +K+L VE++RRE
Sbjct: 161 YKKLSVEVVRRE 172


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.309    0.121    0.294 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,762
Number of Sequences: 429
Number of extensions: 552
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of query: 136
length of database: 140,377
effective HSP length: 52
effective length of query: 84
effective length of database: 118,069
effective search space:  9917796
effective search space used:  9917796
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (20.9 bits)
S2: 40 (20.2 bits)

- SilkBase 1999-2023 -