BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001581-TA|BGIBMGA001581-PA|IPR000953|Chromo, IPR008676|MRG (307 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 31 0.011 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 27 0.23 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 23 2.1 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 4.9 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 4.9 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 31.1 bits (67), Expect = 0.011 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 5/68 (7%) Query: 54 VPESRV---LKYNEANVQRQKEVQRAHSAQPTKTK--KIKESDSTPAPAKTTKTQSKDTP 108 +PESRV K A ++Q + Q+ SA T T K+K S ++PA A + P Sbjct: 166 LPESRVQVWFKNRRAKCRQQLQQQQNKSASRTTTSPTKVKASKASPAAAPRSVATPTGIP 225 Query: 109 ADSGSDQP 116 S S P Sbjct: 226 TPSTSASP 233 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 26.6 bits (56), Expect = 0.23 Identities = 11/39 (28%), Positives = 21/39 (53%) Query: 83 KTKKIKESDSTPAPAKTTKTQSKDTPADSGSDQPKKKRG 121 K + +K+ D + TT + KD+ +DS ++P+ G Sbjct: 76 KPENVKKEDESDEEKPTTSFKLKDSSSDSEDERPRPGGG 114 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/57 (21%), Positives = 23/57 (40%) Query: 49 NWDEWVPESRVLKYNEANVQRQKEVQRAHSAQPTKTKKIKESDSTPAPAKTTKTQSK 105 +W VPE ++ KE++ + +P TK + P P + + + K Sbjct: 223 DWVRNVPECADWYKGRLTDEQLKELENPPTPKPRPTKVSRRKPRPPRPTQVEEEEEK 279 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/28 (28%), Positives = 17/28 (60%) Query: 80 QPTKTKKIKESDSTPAPAKTTKTQSKDT 107 QPT+T + + + ++ P +++ TQ T Sbjct: 402 QPTQTTESEPTQASEQPTESSTTQKPQT 429 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/9 (66%), Positives = 7/9 (77%) Query: 44 AGWNKNWDE 52 +GW K WDE Sbjct: 321 SGWTKKWDE 329 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.130 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,204 Number of Sequences: 317 Number of extensions: 3014 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 6 length of query: 307 length of database: 114,650 effective HSP length: 57 effective length of query: 250 effective length of database: 96,581 effective search space: 24145250 effective search space used: 24145250 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -