BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001580-TA|BGIBMGA001580-PA|undefined (308 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 24 4.7 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 24 6.2 AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. 23 8.2 AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. 23 8.2 AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. 23 8.2 AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. 23 8.2 AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. 23 8.2 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 8.2 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 24.2 bits (50), Expect = 4.7 Identities = 15/59 (25%), Positives = 28/59 (47%) Query: 10 GTEAAHQLVVFVRNKCTPEEALNVLRDLPNPLKEGEQTANQPTAYNPLKIDVFVQTLLN 68 G A L VF+ P+ L + + NPL++ + NQ ++ L + + T+L+ Sbjct: 616 GVFAEEDLQVFLAKNIIPKLELRLTELIVNPLQQDLEIFNQVWEWHELISPLQMATVLD 674 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.8 bits (49), Expect = 6.2 Identities = 13/49 (26%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Query: 26 TPEEALNVLRDLPNPLKEGEQTANQPTAYNPLKIDVFVQ-TLLNLGSKS 73 T + ++ +LP +K GE Q T +N L + TL N+ +++ Sbjct: 682 TTVQPFYIVENLPYSIKRGEAVVLQFTLFNNLGAEYIADVTLYNVANQT 730 >AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 8.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 10 GTEAAHQLVVFVRNKCTPEEALNV 33 GTE H+ VF+ NK + L + Sbjct: 118 GTEDRHECFVFISNKLASDITLTI 141 >AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 8.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 10 GTEAAHQLVVFVRNKCTPEEALNV 33 GTE H+ VF+ NK + L + Sbjct: 118 GTEDRHECFVFISNKLASDITLTI 141 >AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 8.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 10 GTEAAHQLVVFVRNKCTPEEALNV 33 GTE H+ VF+ NK + L + Sbjct: 118 GTEDRHECFVFISNKLASDITLTI 141 >AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 8.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 10 GTEAAHQLVVFVRNKCTPEEALNV 33 GTE H+ VF+ NK + L + Sbjct: 118 GTEDRHECFVFISNKLASDITLTI 141 >AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 8.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 10 GTEAAHQLVVFVRNKCTPEEALNV 33 GTE H+ VF+ NK + L + Sbjct: 118 GTEDRHECFVFISNKLASDITLTI 141 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.4 bits (48), Expect = 8.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 142 EMAPYFTHGCLWEMLHLTIDKMNK 165 ++AP FT G L M H +D N+ Sbjct: 133 KLAPTFTSGKLKAMFHTIVDVGNR 156 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.326 0.135 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 269,389 Number of Sequences: 2123 Number of extensions: 9487 Number of successful extensions: 24 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 17 Number of HSP's gapped (non-prelim): 8 length of query: 308 length of database: 516,269 effective HSP length: 64 effective length of query: 244 effective length of database: 380,397 effective search space: 92816868 effective search space used: 92816868 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -