BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001580-TA|BGIBMGA001580-PA|undefined (308 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 3.8 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 22.6 bits (46), Expect = 3.8 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Query: 87 VFKILAESEEAQICILRNVWELWQRHPQMVCVLIDKML 124 +F +L E +E + LRN E PQ+ + +D ML Sbjct: 74 LFSVLCEIKEKTVLSLRNTQEEEPPDPQL--MRLDNML 109 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/22 (40%), Positives = 16/22 (72%), Gaps = 3/22 (13%) Query: 258 YRATLHRLTQVFLIHHEQVQKY 279 YRA +L Q+ I+H++++KY Sbjct: 147 YRA---KLAQIRQIYHQELEKY 165 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.326 0.135 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,704 Number of Sequences: 317 Number of extensions: 2265 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 308 length of database: 114,650 effective HSP length: 57 effective length of query: 251 effective length of database: 96,581 effective search space: 24241831 effective search space used: 24241831 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -