BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001579-TA|BGIBMGA001579-PA|IPR003890|Initiation factor eIF-4 gamma, middle (492 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 24 2.8 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 22 8.5 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 23.8 bits (49), Expect = 2.8 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 5/69 (7%) Query: 283 TYPMPRV-IFRMFDYTDCPDG----PVLPGVHSIERFLIEEHLHNIIETYHLERKECAAQ 337 TY PR I+ Y+ P G VL +HS +I E + + + RK A Sbjct: 211 TYRAPRPWIYNETIYSLTPQGRKEQKVLKSLHSFSNNVIAERKKHFSSSSYSSRKRLAML 270 Query: 338 LLCFPYKAK 346 L YK++ Sbjct: 271 DLLLKYKSE 279 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 22.2 bits (45), Expect = 8.5 Identities = 20/69 (28%), Positives = 28/69 (40%), Gaps = 5/69 (7%) Query: 283 TYPMPRV-IFRMFDYTDCPDG----PVLPGVHSIERFLIEEHLHNIIETYHLERKECAAQ 337 TY PR I Y+ P G VL +HS +I E + + + RK A Sbjct: 211 TYRAPRPWIHNETIYSLTPQGRKEQKVLKSLHSFSNNVIAERKKHFSSSSYSSRKRLAML 270 Query: 338 LLCFPYKAK 346 L YK++ Sbjct: 271 DLLLKYKSE 279 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.324 0.139 0.449 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,403 Number of Sequences: 317 Number of extensions: 5784 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 2 length of query: 492 length of database: 114,650 effective HSP length: 59 effective length of query: 433 effective length of database: 95,947 effective search space: 41545051 effective search space used: 41545051 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -