BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001578-TA|BGIBMGA001578-PA|undefined (259 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19212| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 >SB_19212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 513 Score = 29.1 bits (62), Expect = 3.8 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 49 LISSIVLVQLFAF-WLFLLMISVFLVLTRTKSAVKVNTVTRKSFHLLASLVFMSGII 104 LI + V L F WLF +++VF+ R+ ++ VN R+ + LL+ F I+ Sbjct: 263 LIGLVPTVALALFVWLFQKILAVFVFKDRSINSKVVNIDNRRCYLLLSFFFFFFNIL 319 >SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3367 Score = 28.7 bits (61), Expect = 5.0 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 208 KWTSLLRNNT-VLIRTMLAASISSVVEAKTDQVDNLI 243 +W + + N + T+LAAS+ + + T+QVDN + Sbjct: 1649 EWLTCVENEMRTTLATLLAASVKEIHQFNTEQVDNSV 1685 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.324 0.137 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,716,228 Number of Sequences: 59808 Number of extensions: 223225 Number of successful extensions: 692 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 692 Number of HSP's gapped (non-prelim): 2 length of query: 259 length of database: 16,821,457 effective HSP length: 81 effective length of query: 178 effective length of database: 11,977,009 effective search space: 2131907602 effective search space used: 2131907602 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -